[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : guaB
DDBJ      :guaB         putative inosine-5'-monophosphate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  45/68 : Bacteria  850/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.1.5
:489 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->486 1zfjA PDBj 3e-93 45.8 %
:RPS:PDB   3->49 1eepA PDBj 1e-05 55.3 %
:RPS:PDB   64->486 3bg3B PDBj 1e-40 11.2 %
:RPS:SCOP  1->86 1ak5A1  c.1.5.1 * 9e-16 31.6 %
:RPS:SCOP  113->468 1ak5A1  c.1.5.1 * 2e-62 22.3 %
:HMM:SCOP  1->479 1pvnA1 c.1.5.1 * 9.4e-121 53.5 %
:RPS:PFM   3->472 PF00478 * IMPDH e-116 53.7 %
:HMM:PFM   3->474 PF00478 * IMPDH 3.7e-145 62.2 347/351  
:BLT:SWISS 1->488 IMDH_MYCTU 0.0 78.5 %
:PROS 290->302|PS00487|IMP_DH_GMP_RED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55740.1 GT:GENE guaB GT:PRODUCT putative inosine-5'-monophosphate dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 996204..997673 GB:FROM 996204 GB:TO 997673 GB:DIRECTION + GB:GENE guaB GB:PRODUCT putative inosine-5'-monophosphate dehydrogenase GB:PROTEIN_ID BAD55740.1 LENGTH 489 SQ:AASEQ MLGLTFDDVLLLPAASDLIPSSVETSSRLTREIRLRTPLVSSAMDTVTEARMAIAMARAGGMGVLHRNLSAADQAAQVETVKRSEAGMVTDPVTCRPTDTLAEVDAMCARFRISGLPVVDETGALVGIITNRDMRFEVDQNRRVADVMTKAPLITAQEGVTAEAALGLLRRHKVEKLPIVDGNGRLRGLITVKDFVKTDQYPNATKDRDGRLLVGAAVGVGEDAWSRAMTLADAGVDVLVVDTAHGHQSQVLQMVAKVKAEVGDRIQVVGGNIATRAGAAALVEAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACKPAGVPVIADGGIQFSGDIAKAIAAGASTVMLGSLLAGTAESPGELILVGGKQFKSYRGMGSLGAMQGRGQAKSFSKDRYFQDDVLAEDKLVPEGIEGRVPFRGPVNQVIHQLVGGLRAAMGYTGSQSIADLQEAQFVQITAAGLKESHPHDITMTVEAPNYTGRS GT:EXON 1|1-489:0| BL:SWS:NREP 1 BL:SWS:REP 1->488|IMDH_MYCTU|0.0|78.5|488/529| PROS 290->302|PS00487|IMP_DH_GMP_RED|PDOC00391| SEG 50->63|armaiamaraggmg| SEG 212->221|llvgaavgvg| SEG 230->244|tladagvdvlvvdta| SEG 274->289|atragaaalveagada| BL:PDB:NREP 1 BL:PDB:REP 3->486|1zfjA|3e-93|45.8|450/463| RP:PDB:NREP 2 RP:PDB:REP 3->49|1eepA|1e-05|55.3|47/314| RP:PDB:REP 64->486|3bg3B|1e-40|11.2|421/603| RP:PFM:NREP 1 RP:PFM:REP 3->472|PF00478|e-116|53.7|456/459|IMPDH| HM:PFM:NREP 1 HM:PFM:REP 3->474|PF00478|3.7e-145|62.2|347/351|IMPDH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 2 RP:SCP:REP 1->86|1ak5A1|9e-16|31.6|86/329|c.1.5.1| RP:SCP:REP 113->468|1ak5A1|2e-62|22.3|310/329|c.1.5.1| HM:SCP:REP 1->479|1pvnA1|9.4e-121|53.5|342/0|c.1.5.1|1/1|Inosine monophosphate dehydrogenase (IMPDH)| OP:NHOMO 1787 OP:NHOMOORG 1087 OP:PATTERN 11---2----------111--1--211112221111111111111111-----311111211111-11 1111211233312122222-2222222222222222222211212221132211222211222222222231111111111112111122111211---212111111111-------11-112-111111111111221211113111111-111111-1111111--12-1111-11111-1111111221222222222222222231331222212222222222222112222222222222122222222222212322122222222222222222222211222222222222222222222222122111222211122111111121111111111111112111111111121221111111111111111111111111112122211111111111-11111111111111111111111111111111212211211111111111111121111111111---------------111113211111111111111111111111111111111111111111212222222222221111211111111111111211112111211111222111111222222121111111111111222222211111112221111111111111113111111211111-1111111-11122222222222222222-222222222222222222222222111222222222222222222222222112222222222221111111112222111111111111121111111111111111111111211111111111111111111112222222222222211111111111111112111111111111-1-1-1----2------------11------1-11111111111 1111112-522-1111111-11111111111111111111111111111111111111111112111111112-13346511112211-11111111111111212-12148656854444444453E4On9-86C3443644441432343394424424A32221311323321111I1112121231211143432 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 488 STR:RPRED 99.8 SQ:SECSTR HHcccTTcEEEccccccccGGGccccEEcccccEEcccEEEcccTTTccTHHHHHHHHTTcEEHHHHHHcHHHHHHHHHHccccEEEEcTHHHHcTTcccHHHHHHTHHHHHHHcTTcEEEEEETTHHHHHHHTccccHHHHHHHHHcccccEEcGGGTTccccccHHHHHHHHHHHHTTTcEEEEccTTccHHHHHHHHEEEEEEccccTTcTTcccccHHHHHHHHHHHHHHTccEEEEETTccccHHHHHHHHHHHTTcTTccEEEccHHHHHHHHHHTTccEEEEccGGGcTccccHHHHHHcccHHHHHHHHHHHHHHHHTTGGGcGGGTccccHHHHHTTTTcccTTTccccHHHHHHHHHHHHHHTTcccccTTHHHHHHHHHHHHHHTTcccHHHHcTTTccccHHHHHHHTTTccTTcccHHHHHHHHTTcccccccHHHHcccccHHHHHHHHHHcccHcccHHHHHHHHHcHHHHGG# DISOP:02AL 389-400, 484-489| PSIPRED cccEEEccEEEcccccccccccEEEcHHcccccEEEccEEEcccccccHHHHHHHHHHHHccEEEcccccHHHHHHHHHHHHHEEcEEEEccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHccccccHHHHcccccEEEEcccccHHHHHHHHHHccccEEEEEEcccEEEEEEHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEEEcccccccccHHHHHcccccHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHccccEEEEccHHHccccccccEEEEccEEEEEccccccHHHHHHcccccccccccccHHHHcccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHcccccHHHHHcEEEEEEcHHHccccccccEEEccccccccccc //