[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : hisA
DDBJ      :hisA         putative phosphoribosylformimino-5- aminoimidazole carboxamide ribotide isomerase
Swiss-Prot:HIS4_NOCFA   RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase;         EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase;

Homologs  Archaea  55/68 : Bacteria  713/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->241 2vepA PDBj 7e-83 64.7 %
:RPS:PDB   1->243 2a0nA PDBj 9e-23 22.7 %
:RPS:SCOP  4->243 1qo2A  c.1.2.1 * 9e-58 28.6 %
:HMM:SCOP  1->243 1vzwA1 c.1.2.1 * 2.7e-59 37.2 %
:RPS:PFM   5->231 PF00977 * His_biosynth 4e-22 34.1 %
:HMM:PFM   5->234 PF00977 * His_biosynth 9.3e-64 39.0 223/228  
:BLT:SWISS 1->243 HIS4_NOCFA e-137 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56696.1 GT:GENE hisA GT:PRODUCT putative phosphoribosylformimino-5- aminoimidazole carboxamide ribotide isomerase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2023600..2024331 GB:FROM 2023600 GB:TO 2024331 GB:DIRECTION + GB:GENE hisA GB:PRODUCT putative phosphoribosylformimino-5- aminoimidazole carboxamide ribotide isomerase GB:PROTEIN_ID BAD56696.1 LENGTH 243 SQ:AASEQ MSLVLLPAVDVANGEAVRLVQGEAGSETSYGSPRDAALAWQEAGAEWVHLVDLDAAFGRGSNRELLAKVVGELDVKVELSGGIRDDDSLEAALATGCARVNLGTAALEDPQWCARAIAKHGERIAVGLDVRIIDGDYRLRGRGWVSDGGDLWEVLERLERDGCSRYVVTDVTKDGTLTGPNLELLSEVCAATEAPVIASGGVSAIEDLVAIAGLVPEGVEGAIVGKALYAGRFTLPEALAAVR GT:EXON 1|1-243:0| SW:ID HIS4_NOCFA SW:DE RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; SW:GN Name=hisA; OrderedLocusNames=NFA_18500; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->243|HIS4_NOCFA|e-137|100.0|243/243| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| BL:PDB:NREP 1 BL:PDB:REP 3->241|2vepA|7e-83|64.7|235/240| RP:PDB:NREP 1 RP:PDB:REP 1->243|2a0nA|9e-23|22.7|238/251| RP:PFM:NREP 1 RP:PFM:REP 5->231|PF00977|4e-22|34.1|223/229|His_biosynth| HM:PFM:NREP 1 HM:PFM:REP 5->234|PF00977|9.3e-64|39.0|223/228|His_biosynth| GO:PFM:NREP 1 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00977|IPR006062| RP:SCP:NREP 1 RP:SCP:REP 4->243|1qo2A|9e-58|28.6|234/241|c.1.2.1| HM:SCP:REP 1->243|1vzwA1|2.7e-59|37.2|239/0|c.1.2.1|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1537 OP:NHOMOORG 772 OP:PATTERN ---2--2122222222-2222122222222222123314323322221321112-2-222-2----12 2222222222222222211-12222222222221112222222122232222222222--122221222222222222--22222222222222-----2-222222222---------------222222222222222233322222222222222123222222222222222223233222222222222222222222222222222221222222122222222221-22222222222222122-2----22-2---22--21----2-222-------222------------------------2----2----22-2222222-2-2222222---2-2--2212222222222222222--22222222-----232222311211222222222222123232222221-2222222222222222222222222332222222222222222-----------------------------22222222222222222222222222222222222222222222222222222232322222222222222222222-323-222222222-2223223222222223322222233332-2-------22222222221222211222222122222222222221--222211111122222222222222222-2222222222222222222222223322222222222222222222222222-22222221222211-2-----233222321211222-2221---2222222222222323222222222222222--------222222222222223112222222222222222223322--------------------------------------2--2-222221 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1---------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEEETTEETTccccTTcccTcHTcHHHHHHHHHHHTccEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHTccEEEEcHHHHHcTHHHHHHHHHHcGGGEEEEEEEEETTEEEEEETTTTEEEEEEHHHHHHHHHHTccEEEEEETTTTTccccccHHHHHHHGGGccccEEEEcccccHHHHHHHHHHHHTTccEEEEcHHHHTTcccHHHHHHHHH DISOP:02AL 243-244| PSIPRED ccEEEEEEEEEEccEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEccHHcccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEccHHHHcHHHHHHHHHHccccEEEEEEEEEEcccEEEEEcccccccccHHHHHHHHHHccccEEEEEEccHHHHcccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEEHHHcccccHHHHHHHHc //