[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : hisF
DDBJ      :hisF         putative cyclase
Swiss-Prot:HIS6_NOCFA   RecName: Full=Imidazole glycerol phosphate synthase subunit hisF;         EC=4.1.3.-;AltName: Full=IGP synthase cyclase subunit;AltName: Full=IGP synthase subunit hisF;AltName: Full=ImGP synthase subunit hisF;         Short=IGPS subunit hisF;

Homologs  Archaea  55/68 : Bacteria  715/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->257 1ka9F PDBj 8e-75 61.8 %
:RPS:PDB   4->257 2a0nA PDBj 1e-31 47.4 %
:RPS:SCOP  4->257 1gpwA  c.1.2.1 * 2e-81 47.0 %
:HMM:SCOP  2->257 1thfD_ c.1.2.1 * 1.8e-80 46.2 %
:RPS:PFM   6->216 PF00977 * His_biosynth 1e-60 63.9 %
:HMM:PFM   6->241 PF00977 * His_biosynth 2.2e-91 52.0 225/228  
:BLT:SWISS 1->257 HIS6_NOCFA e-134 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56698.1 GT:GENE hisF GT:PRODUCT putative cyclase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2025173..2025946 GB:FROM 2025173 GB:TO 2025946 GB:DIRECTION + GB:GENE hisF GB:PRODUCT putative cyclase GB:PROTEIN_ID BAD56698.1 LENGTH 257 SQ:AASEQ MTVAVRVIPCLDVDAGRVVKGVNFQNLRDAGDPVELAATYDAQGADELTFLDVTASTGDRGTMIDVVTRTAEQIFIPLTVGGGVRTVEDVDRLLRAGADKVSVNTAAIARPEVLREMSERFGSQCIVLSVDARTVPDGQPDTPSGWEVTTHGGKRGTGIDAVEWAERGAELGVGEILLNSMDADGTKTGFDLPMIRAVRAAVSIPVIASGGAGAVEHFAPAVQAGADAVLAASVFHFGDLTIGQVKDSLRDAHLVVR GT:EXON 1|1-257:0| SW:ID HIS6_NOCFA SW:DE RecName: Full=Imidazole glycerol phosphate synthase subunit hisF; EC=4.1.3.-;AltName: Full=IGP synthase cyclase subunit;AltName: Full=IGP synthase subunit hisF;AltName: Full=ImGP synthase subunit hisF; Short=IGPS subunit hisF; SW:GN Name=hisF; OrderedLocusNames=NFA_18520; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->257|HIS6_NOCFA|e-134|100.0|257/257| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| SEG 219->234|apavqagadavlaasv| BL:PDB:NREP 1 BL:PDB:REP 2->257|1ka9F|8e-75|61.8|249/251| RP:PDB:NREP 1 RP:PDB:REP 4->257|2a0nA|1e-31|47.4|247/251| RP:PFM:NREP 1 RP:PFM:REP 6->216|PF00977|1e-60|63.9|202/229|His_biosynth| HM:PFM:NREP 1 HM:PFM:REP 6->241|PF00977|2.2e-91|52.0|225/228|His_biosynth| GO:PFM:NREP 1 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00977|IPR006062| RP:SCP:NREP 1 RP:SCP:REP 4->257|1gpwA|2e-81|47.0|247/253|c.1.2.1| HM:SCP:REP 2->257|1thfD_|1.8e-80|46.2|249/0|c.1.2.1|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1654 OP:NHOMOORG 887 OP:PATTERN ---2--2111111111-1111112222222222222223222222222322222-1-112-1----22 2121222222222222222-22222222222222222222222222232222222222--222222211121111211--21122222111222-----2-222211223---------------222222223222222233322222222222223223222222222223222334233222222112222222222222222222222222222222122222222221-11111111111111211-1----21-2---22--22----2-222-------222------------------------2----2----12-2222222-2-2222222---2-2--1212222222222222212--22222222-----222222322222222222222222122222222222-2222222322222222222222222332222222222222222-----------------------------2322222222222222222222222222222222222222222222222232224233222222222222222222214231222212222-2223223222222213342222333333-1-------22222222222222222222222222222222222222--222222222221222222222222222-2222222222222222222222223322222222222222222222222222-22222221222222-1-----333322321222222-2221---2222222222222323222222222222222--------222222222222224222222222222222232223222--------------------------------------1--2-211221 ------1-----111111111111211111111111111111111111111111-111111111111111111111111111111-11-12111111111121111-11----------------------------------------------------------------3-1-118111111113111111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 100.0 SQ:SECSTR HHHccEEEEEEEEETTEETTccccTTcccTTcHHHHHHHHHHHTccEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHTccEEEEcHHHHHcTHHHHHHHHHHcGGGEEEEEEEEEETTEccTTcGEEEEEETTTTEEEEEEHHHHHHHHHHTTccEEEEEETTTTTccccccHHHHHHHGGGccccEEEEcccccHHHHHHHHHTTccEEEEcHHHHTTcccHHHHHHHHHHTTcccc DISOP:02AL 257-258| PSIPRED ccccEEEEEEEEEEccEEEEEEccccEEEcccHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccccEEEEcccEEcccccccccccEEEEEccccccccccHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHcccccc //