[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : hisH
DDBJ      :hisH         putative amidotransferase
Swiss-Prot:HIS5_NOCFA   RecName: Full=Imidazole glycerol phosphate synthase subunit hisH;         EC=2.4.2.-;AltName: Full=IGP synthase glutamine amidotransferase subunit;AltName: Full=IGP synthase subunit hisH;AltName: Full=ImGP synthase subunit hisH;         Short=IGPS subunit hisH;

Homologs  Archaea  55/68 : Bacteria  711/915 : Eukaryota  114/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->204 1ka9H PDBj 8e-27 41.8 %
:RPS:PDB   6->209 2d7jA PDBj 2e-27 21.0 %
:RPS:SCOP  4->208 1jvnA2  c.23.16.1 * 7e-49 34.7 %
:HMM:SCOP  4->209 1jvnA2 c.23.16.1 * 5.6e-51 41.7 %
:RPS:PFM   7->200 PF00117 * GATase 1e-09 34.9 %
:HMM:PFM   8->208 PF00117 * GATase 3.3e-31 30.1 176/192  
:BLT:SWISS 1->211 HIS5_NOCFA e-123 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56694.1 GT:GENE hisH GT:PRODUCT putative amidotransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2021988..2022623 GB:FROM 2021988 GB:TO 2022623 GB:DIRECTION + GB:GENE hisH GB:PRODUCT putative amidotransferase GB:PROTEIN_ID BAD56694.1 LENGTH 211 SQ:AASEQ MTRKSVALLDYGSGNLHSAERALVRAGADVRVTADPDAALAVDGLVVPGVGAFAACMAGLRAVRGEKIIGQRLAGGRPVLGICVGMQILFERGVEFGVETEGCAEWPGVVERLDAPVLPHMGWNTVSAPADSVLFAGMDADTRFYFVHSYAAQRWELPPNEHFAAPKLTWAEHGVRFLAAVENGPLSATQFHPEKSGDAGAQLLRNWVDSL GT:EXON 1|1-211:0| SW:ID HIS5_NOCFA SW:DE RecName: Full=Imidazole glycerol phosphate synthase subunit hisH; EC=2.4.2.-;AltName: Full=IGP synthase glutamine amidotransferase subunit;AltName: Full=IGP synthase subunit hisH;AltName: Full=ImGP synthase subunit hisH; Short=IGPS subunit hisH; SW:GN Name=hisH; OrderedLocusNames=NFA_18480; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Glutamine amidotransferase; Histidine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->211|HIS5_NOCFA|e-123|100.0|211/211| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 8->204|1ka9H|8e-27|41.8|184/195| RP:PDB:NREP 1 RP:PDB:REP 6->209|2d7jA|2e-27|21.0|181/188| RP:PFM:NREP 1 RP:PFM:REP 7->200|PF00117|1e-09|34.9|166/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 8->208|PF00117|3.3e-31|30.1|176/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 4->208|1jvnA2|7e-49|34.7|202/232|c.23.16.1| HM:SCP:REP 4->209|1jvnA2|5.6e-51|41.7|199/232|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 940 OP:NHOMOORG 880 OP:PATTERN ---1--1111111111-1111111111111111111112111111111111111-1-111-1----11 1111111111111111111-111111111111111111111111111-1111111111--111111111111111111--11111111111111-----1-111111112---------------111111112111111111111111111111112112111111111112111223122111111111111111111111111111111111111111111111111111-11111111111111111-1----11-2---11--11----1-111-------111------------------------1----1----11-1111111-1-111111----1-1--1111111111-11111111--11111111-----111111211111111111111111111111111111-1111111211111111111111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111121112122111111111111111111113211111111111-1112112111111111131111222222-1-------11111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----222211211111111-1111---11111111111112111111111111-1111--------111111111111113111111111111111121112211--------------------------------------1--1-111111 ------1-----11111111111121111111111111-111111111111111111111111111111111111111111---1111-12111111-11-21111-11------------------------------------------------------1-1-------1-1-118111111212-11111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 99.1 SQ:SECSTR cccEEEEEEEcccTTHHHHHHHHHHTTccEEEEETTccHHHHHTTcccEEEEcccccTTTccTTHHHHHHTGGGTcccEEEETHHHHHHHHHEHETTcEEEEcccGGcccccEEEEEEcccEEEEEEEcccTTTTTTcccEEEEEEcccEEEEEEEccTTEEEEEcEEEEcccccccEEEEccccEEEEcccTTcTTcTHHHHHHHHHH## DISOP:02AL 1-2| PSIPRED ccccEEEEEEccccHHHHHHHHHHHcccEEEEEEcHHHHHcccEEEEccccccHHHHHHHHHcccHHHHHHHHHccccEEEEHHHHHHHHHHHcccccccccccccccEEEEcccccccccccEEEEEcccccEEcccccccEEEEEEEEEEccccccccccEEEEEEEccccccEEEEEEEcccEEEEEEccccccHHHHHHHHHHHHHc //