[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : hisI
DDBJ      :hisI         putative phosphoribosyl-AMP cyclohydrolase
Swiss-Prot:HIS3_NOCFA   RecName: Full=Phosphoribosyl-AMP cyclohydrolase;         Short=PRA-CH;         EC=3.5.4.19;

Homologs  Archaea  55/68 : Bacteria  703/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
b.168.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->110 1zpsB PDBj 2e-23 50.5 %
:RPS:SCOP  3->113 1zpsA1  b.168.1.1 * 2e-36 42.3 %
:HMM:SCOP  3->113 1zpsA1 b.168.1.1 * 1.5e-39 54.1 %
:RPS:PFM   33->105 PF01502 * PRA-CH 3e-20 53.4 %
:HMM:PFM   33->106 PF01502 * PRA-CH 1.3e-37 63.5 74/75  
:BLT:SWISS 1->115 HIS3_NOCFA 1e-57 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56700.1 GT:GENE hisI GT:PRODUCT putative phosphoribosyl-AMP cyclohydrolase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2026181..2026528 GB:FROM 2026181 GB:TO 2026528 GB:DIRECTION + GB:GENE hisI GB:PRODUCT putative phosphoribosyl-AMP cyclohydrolase GB:PROTEIN_ID BAD56700.1 LENGTH 115 SQ:AASEQ MSLDPAIAARLKRNEAGLVAAVAQERATGDVLMMAWMDDEALARTLATRKATYYSRSRQQYWVKGETSGHTQYVHEVRLDCDGDTVLLIVDQEGAACHTGTHTCWDGDVLLAEPA GT:EXON 1|1-115:0| SW:ID HIS3_NOCFA SW:DE RecName: Full=Phosphoribosyl-AMP cyclohydrolase; Short=PRA-CH; EC=3.5.4.19; SW:GN Name=hisI; OrderedLocusNames=NFA_18540; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->115|HIS3_NOCFA|1e-57|100.0|115/115| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 41->52|alartlatrkat| BL:PDB:NREP 1 BL:PDB:REP 14->110|1zpsB|2e-23|50.5|97/128| RP:PFM:NREP 1 RP:PFM:REP 33->105|PF01502|3e-20|53.4|73/75|PRA-CH| HM:PFM:NREP 1 HM:PFM:REP 33->106|PF01502|1.3e-37|63.5|74/75|PRA-CH| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF01502|IPR002496| GO:PFM GO:0004635|"GO:phosphoribosyl-AMP cyclohydrolase activity"|PF01502|IPR002496| RP:SCP:NREP 1 RP:SCP:REP 3->113|1zpsA1|2e-36|42.3|111/124|b.168.1.1| HM:SCP:REP 3->113|1zpsA1|1.5e-39|54.1|111/0|b.168.1.1|1/1|HisI-like| OP:NHOMO 809 OP:NHOMOORG 788 OP:PATTERN ---1--1111111111-1111111111111111111111111111111111111-1-111-1----11 1111111111111111111-11111111111111111111111111111111111111--111111111111111111--11111111111111-----1-111111111---------------111111111111111111111121111111111111111111211211111111111111111111111-11-11111111111111111111111111111111111-11111111111111111-1----11-1---11--11----1-111-------111------------------------1----1----11-1111--1-1-1111111---1-1--1111111111111111111--11111111-----111111111111111111111111111111111111-1111111111111111111211111111111111111111111-----------------------------11111111111111111111111111111111111111111111111111111111131111111111111111111-1111111111111-111111111----111-11111111111-1-------11111111112111111111111111111111111111--111111111111111111111111111-1111111111111111111112111111111111111111111111111111-11111111111111-1-----111111211111111-11-----1111111111111111112122111111111--------111111111111111111111111111111111111111--------------------------------------1--1-111111 ------------------------------------------------1-1--1-----------1-1--11---111111----------------------------------------------------------------------------------------------1111811111-111-1111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 84.3 SQ:SECSTR #############TTEEEEEEEEEETTTccEEEEEEEcHHHHHHHHHHcccEEEETTTTEEEETTTTTcccEEEEEEEEcTTccEEEEEEEEcccccTTccccccETTEE##### DISOP:02AL 114-115| PSIPRED ccccHHHHHHcccccccEEEEEEEEcccccEEEEEEccHHHHHHHHHccEEEEEEEccccEEEEccccccEEEEEEEEEcccccEEEEEEEcccccEEcccccccccEEEEEccc //