[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : hutI
DDBJ      :hutI         putative imidazolone-5-propionate hydrolase
Swiss-Prot:HUTI_NOCFA   RecName: Full=Imidazolonepropionase;         EC=3.5.2.7;AltName: Full=Imidazolone-5-propionate hydrolase;

Homologs  Archaea  8/68 : Bacteria  349/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->383 2gokA PDBj 4e-47 34.7 %
:RPS:PDB   10->380 3e0lA PDBj 4e-19 10.4 %
:RPS:SCOP  16->92 2gokA1  b.92.1.10 * 7e-10 19.5 %
:RPS:SCOP  64->329 2bb0A2  c.1.9.17 * 1e-80 35.1 %
:HMM:SCOP  25->64 1yrrA1 b.92.1.5 * 9.7e-05 32.5 %
:HMM:SCOP  65->347 1j6pA2 c.1.9.9 * 3.4e-40 26.7 %
:HMM:PFM   62->362 PF01979 * Amidohydro_1 1e-13 22.0 254/328  
:BLT:SWISS 1->392 HUTI_NOCFA 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56079.1 GT:GENE hutI GT:PRODUCT putative imidazolone-5-propionate hydrolase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1371962..1373140 GB:FROM 1371962 GB:TO 1373140 GB:DIRECTION + GB:GENE hutI GB:PRODUCT putative imidazolone-5-propionate hydrolase GB:PROTEIN_ID BAD56079.1 LENGTH 392 SQ:AASEQ MPTTALTGIGQLVTNDPALGEGPLGLRRDAAIVFEDGVVAWVGDSAHVPATDTAHDLDGRAVLPGFVESHSHLVFAGDRAEEFAARMSGRPYGAGGIRTTIEATRAATDEQLGANVRRLLDESLRAGSTTVECKSGYGQSVEHELRSVRVAGRYTDEVTLLAAHVPPPEYAGRVDDYVAMACAEMIPRCAPHAKWIDVFCEQGAFDRDQAHAVLTAGIAHGLVPRVHGNQLHRGPGVQLAVEVGAASVDHVTYIDDADIEALAHSDTVATLLPGADFCTRNSYPDARALLDAGVTVALGADCNPGTSYTTSLPFCIALAVRELRMTPDEAVWAATAGGARALRRGDVGVLTPGARADALALDAPSHLHLAYRPGVPLISRVWREGTLAYATN GT:EXON 1|1-392:0| SW:ID HUTI_NOCFA SW:DE RecName: Full=Imidazolonepropionase; EC=3.5.2.7;AltName: Full=Imidazolone-5-propionate hydrolase; SW:GN Name=hutI; OrderedLocusNames=NFA_12340; SW:KW Complete proteome; Cytoplasm; Histidine metabolism; Hydrolase; Iron;Metal-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->392|HUTI_NOCFA|0.0|100.0|392/392| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006547|"GO:histidine metabolic process"|Histidine metabolism| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| SEG 97->108|irttieatraat| SEG 330->349|avwaataggaralrrgdvgv| BL:PDB:NREP 1 BL:PDB:REP 4->383|2gokA|4e-47|34.7|378/404| RP:PDB:NREP 1 RP:PDB:REP 10->380|3e0lA|4e-19|10.4|364/442| HM:PFM:NREP 1 HM:PFM:REP 62->362|PF01979|1e-13|22.0|254/328|Amidohydro_1| RP:SCP:NREP 2 RP:SCP:REP 16->92|2gokA1|7e-10|19.5|77/103|b.92.1.10| RP:SCP:REP 64->329|2bb0A2|1e-80|35.1|265/300|c.1.9.17| HM:SCP:REP 25->64|1yrrA1|9.7e-05|32.5|40/0|b.92.1.5|1/1|Composite domain of metallo-dependent hydrolases| HM:SCP:REP 65->347|1j6pA2|3.4e-40|26.7|266/0|c.1.9.9|1/1|Metallo-dependent hydrolases| OP:NHOMO 435 OP:NHOMOORG 421 OP:PATTERN -----------------1-1----111----------------------------------111---- -12-11-------------------1----------1111----1111----111111--11111-11111-----------1-----1111-111---1-11111---1--------------------------111-----1--------------------------------------111-------111111111111111111---11111111---------1-1111111111111111---1-----------------------------1---1-------------11111111111111----------11---------------------1---1-----------1---11-12-1--1111-------111--------11-11111111-1-1--1--12--111111111111---11--11-11111--------1--1--11--------------------------------11------1111111111111111111111111111--111--1--1-1-11-------1-----------1--1-1-1-------------------111111-1---------------------------11-1--111111111111111111111111-------------1-11-11-------------------1----------111--11-11111111111111111---------111111111111---1-----1111--1-1---------------111111--111-1111111111111-111----------111111111111111111111111-------1--------------1---------------------------11111-1------ ----11-----------------------------------------------------------------------------------------------------1-12111111111111111111161-111-111111111-1-11111111111221111------121-------------------31111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 390 STR:RPRED 99.5 SQ:SECSTR EEEEEEEEEEEEEccccccccccEEEEEEEEEEcTTccEEEEEEGGGccGGGEEEccTTcEEEEcEEEEEEEGGGGGGTTccccccHHHHHHHTHHccHHHHHHGGGcHHHHHHHHHHHHHHHHHTTEEEEEEEccccHHHHHHHHHHHHHHEEEEEcEEcccccccTTccccHHHHHHHHHHHHHHHTTccccEEEEEEEcccccHHHHHHHHHHHHHHTcEEEEEEcccHHHHHHHHHHccccccHHHHTTccHHHHHHHHHHTcEEEEcHHHHHHTTcccccHHHHHHTTcEEEEcccTTTcccHHHHHHHHHHTTcccccccHHHHHHHTHHHHHHTTcTTTcccccTTccccEEEEcTTcTTccccccTTTTcccEEEEcEEEEE## DISOP:02AL 391-392| PSIPRED ccHHHHHcccEEEEcccccccccccEEcccEEEEEccEEEEEccccccccccEEEEccccEEcccccccccccccccccccHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHcccccEEcccccccHHHHccHHHHHHHHHHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHHHccccEEEHHHHHccccHHHHHHHHcccEEEHHEEccHHHHHHHHHcccEEEEccccHHHHHccccHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccEEcccccccEEEEccccHHHHHHHcccccEEEEEEccEEEEEcc //