[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : infA
DDBJ      :infA         putative translation initiation factor IF-1
Swiss-Prot:IF1_RHOSR    RecName: Full=Translation initiation factor IF-1;

Homologs  Archaea  0/68 : Bacteria  897/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->71 1ah9A PDBj 5e-24 69.1 %
:RPS:PDB   2->73 1ah9A PDBj 1e-18 69.0 %
:RPS:SCOP  1->72 1jt8A  b.40.4.5 * 3e-19 22.9 %
:HMM:SCOP  2->72 1hr0W_ b.40.4.5 * 1.4e-28 62.0 %
:RPS:PFM   8->71 PF01176 * eIF-1a 1e-23 78.1 %
:HMM:PFM   8->71 PF01176 * eIF-1a 2.5e-31 52.4 63/65  
:BLT:SWISS 1->73 IF1_RHOSR 1e-38 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55677.1 GT:GENE infA GT:PRODUCT putative translation initiation factor IF-1 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 927972..928193 GB:FROM 927972 GB:TO 928193 GB:DIRECTION + GB:GENE infA GB:PRODUCT putative translation initiation factor IF-1 GB:PROTEIN_ID BAD55677.1 LENGTH 73 SQ:AASEQ MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK GT:EXON 1|1-73:0| SW:ID IF1_RHOSR SW:DE RecName: Full=Translation initiation factor IF-1; SW:GN Name=infA; OrderedLocusNames=RHA1_ro06157; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->73|IF1_RHOSR|1e-38|100.0|73/73| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 4->71|1ah9A|5e-24|69.1|68/71| RP:PDB:NREP 1 RP:PDB:REP 2->73|1ah9A|1e-18|69.0|71/71| RP:PFM:NREP 1 RP:PFM:REP 8->71|PF01176|1e-23|78.1|64/66|eIF-1a| HM:PFM:NREP 1 HM:PFM:REP 8->71|PF01176|2.5e-31|52.4|63/65|eIF-1a| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF01176|IPR006196| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF01176|IPR006196| GO:PFM GO:0006413|"GO:translational initiation"|PF01176|IPR006196| RP:SCP:NREP 1 RP:SCP:REP 1->72|1jt8A|3e-19|22.9|70/102|b.40.4.5| HM:SCP:REP 2->72|1hr0W_|1.4e-28|62.0|71/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 988 OP:NHOMOORG 907 OP:PATTERN -------------------------------------------------------------------- 1121211111111111111-11111111111111111111111111111111111111111111111211111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1112111111111111111111111111111211111111111111111111111111111-11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111222122222233232321112222222221222333312222212332121111112222221-1111111122211111112112222-11111111122221111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111112111111111111111111-1111111---1-11111111111111-11121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1---2-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 100.0 SQ:SECSTR cccccccEEccEEEEEEccccEEEEEETTccEEEEEEcccGGGTTccccTTcEEccEEccccTTEEEEccccc DISOP:02AL 1-3| PSIPRED ccccccEEEEEEEEEEcccccEEEEEEccccEEEEEEccEEEEEEEEEEEccEEEEEEccccccccEEEEEEc //