[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : infC
DDBJ      :infC         putative translation initiation factor IF-3
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  879/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
d.15.8d.68.1
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->35 1tifA PDBj 3e-08 62.5 %
:BLT:PDB   57->139 1tigA PDBj 2e-20 50.6 %
:RPS:PDB   51->139 2crqA PDBj 9e-18 21.3 %
:RPS:SCOP  1->50 1tifA  d.15.8.1 * 3e-15 54.0 %
:RPS:SCOP  57->141 1tigA  d.68.1.1 * 3e-29 49.4 %
:HMM:SCOP  1->50 1tifA_ d.15.8.1 * 3.9e-17 60.0 %
:HMM:SCOP  54->143 2ifeA_ d.68.1.1 * 1.7e-29 50.0 %
:RPS:PFM   3->49 PF05198 * IF3_N 2e-12 66.0 %
:RPS:PFM   57->139 PF00707 * IF3_C 3e-17 55.4 %
:HMM:PFM   54->141 PF00707 * IF3_C 4.2e-35 54.5 88/88  
:HMM:PFM   1->49 PF05198 * IF3_N 1.1e-22 61.2 49/76  
:BLT:SWISS 1->144 IF3_CORGB 2e-66 83.3 %
:PROS 30->43|PS00938|IF3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56760.1 GT:GENE infC GT:PRODUCT putative translation initiation factor IF-3 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2092347..2092883 GB:FROM 2092347 GB:TO 2092883 GB:DIRECTION + GB:GENE infC GB:PRODUCT putative translation initiation factor IF-3 GB:PROTEIN_ID BAD56760.1 LENGTH 178 SQ:AASEQ MRVEDALRVAMEADLDLVEVAPDARPPVCKIMDYGKFKYETAQKARESRKNQQQTVIKEQKLRPKIDDHDYETKKGHVMRFLEAGSKVKVTIMFRGREQSRPELGYRLLQRLAGDVADLGFVETSAKQDGRNMTMVLAPHKGAKTRVKAQQAATRPQQGAAPAGGTPAAGQGEQAGPQ GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 1->144|IF3_CORGB|2e-66|83.3|144/189| PROS 30->43|PS00938|IF3|PDOC00723| SEG 149->177|aqqaatrpqqgaapaggtpaagqgeqagp| BL:PDB:NREP 2 BL:PDB:REP 4->35|1tifA|3e-08|62.5|32/76| BL:PDB:REP 57->139|1tigA|2e-20|50.6|83/88| RP:PDB:NREP 1 RP:PDB:REP 51->139|2crqA|9e-18|21.3|89/112| RP:PFM:NREP 2 RP:PFM:REP 3->49|PF05198|2e-12|66.0|47/74|IF3_N| RP:PFM:REP 57->139|PF00707|3e-17|55.4|83/87|IF3_C| HM:PFM:NREP 2 HM:PFM:REP 54->141|PF00707|4.2e-35|54.5|88/88|IF3_C| HM:PFM:REP 1->49|PF05198|1.1e-22|61.2|49/76|IF3_N| GO:PFM:NREP 4 GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF05198|IPR019814| GO:PFM GO:0006413|"GO:translational initiation"|PF05198|IPR019814| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF00707|IPR019815| GO:PFM GO:0006413|"GO:translational initiation"|PF00707|IPR019815| RP:SCP:NREP 2 RP:SCP:REP 1->50|1tifA|3e-15|54.0|50/76|d.15.8.1| RP:SCP:REP 57->141|1tigA|3e-29|49.4|85/88|d.68.1.1| HM:SCP:REP 1->50|1tifA_|3.9e-17|60.0|50/76|d.15.8.1|1/1|Translation initiation factor IF3, N-terminal domain| HM:SCP:REP 54->143|2ifeA_|1.7e-29|50.0|90/0|d.68.1.1|1/1|Translation initiation factor IF3, C-terminal domain| OP:NHOMO 929 OP:NHOMOORG 899 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111211111111111111111112221111111111111111111111111111111111111111111-111111111111111112211111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111-111111111111111111111111111-1111111111111111111111111111111-111111111111111111111111211111111111111111111111111111111111111111-111111111111111111111-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111--1111111111111111111-11-11-111----1--11111-11111111111111111111111111111111-11111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111-11111-1111111111111111111111111111111111111111111-111-1-1---11-11-1111111111111111 ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------2--1-21-18242214112-2111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 69.1 SQ:SECSTR ###HHHHHHHHHTTcEEEEEETTccccEEEEEcHH###############ccccccEEEEEEETTccHHHHHHHHHHHHHHHHTTcEEEEEEEccTTccccHHHHHHHHHHHHTTcTTTcEEEEEEEGGGTEEEEEEEccc##################################### DISOP:02AL 39-57, 141-178| PSIPRED ccHHHHHHHHHHccccEEEEcccccccEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEEcccHHccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEcccHHHHHHHHHHcccccccccccccccccccccccccc //