[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : kdpA
DDBJ      :kdpA         putative potassium transporter A subunit
Swiss-Prot:ATKA_NOCFA   RecName: Full=Potassium-transporting ATPase A chain;         EC=3.6.3.12;AltName: Full=Potassium-translocating ATPase A chain;AltName: Full=ATP phosphohydrolase [potassium-transporting] A chain;AltName: Full=Potassium-binding and translocating subunit A;

Homologs  Archaea  8/68 : Bacteria  384/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:561 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->560 PF03814 * KdpA e-100 49.2 %
:HMM:PFM   9->561 PF03814 * KdpA 2.6e-204 55.7 544/555  
:BLT:SWISS 1->561 ATKA_NOCFA 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56412.1 GT:GENE kdpA GT:PRODUCT putative potassium transporter A subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1715637..1717322 GB:FROM 1715637 GB:TO 1717322 GB:DIRECTION + GB:GENE kdpA GB:PRODUCT putative potassium transporter A subunit GB:PROTEIN_ID BAD56412.1 LENGTH 561 SQ:AASEQ MSPALAAGLQIASVVAVLALVYVPLGDYMARVYTSSSDLRAESWLYRLARVDPRAEQTWCGYAGSVLGFSLAGVLVLYVLQRIQGVLPLSHGLAGVSPAVAFNTAVSFVTNTNWQSYVPETTMSPLTQSAGLAVQNFVSAAVGMAVAVALIRGLVRVGRGGEVGNFWVDLTRGTLRILLPLAFVIALILLSQGVIQSYRSGFTGVGLDGRPVTTALAPVASQEAIKELGTNGGGVLAANSAHPFENPTPLSNVVQILAILLIPVALTRTFGTMIGNRRQGLTVLAVMAGIYAVILGVTTAAESGARGAAATAAGAMLEGKEVRFGIPGSVLFAVSTTGTSTGAVNSAHDSMSPLGGGAVLVNMLLGEIAPGGVGSGLYGILVLAVIAVFVGGLLVGRTPEFLGKKLRRREITLAALAVLVMPALVLIGTAITVVLPETAAALGNSGDPGTPGAVHGFSEVLYAYASASNNNGSAFGGLTVTSDWFQSSLGLCMLFGRFLPILFVLALAGSLAAQPRTPATAGTLPTAGAGFAGLLTGTVVLVAALTFFPVLALGPIAEALQ GT:EXON 1|1-561:0| SW:ID ATKA_NOCFA SW:DE RecName: Full=Potassium-transporting ATPase A chain; EC=3.6.3.12;AltName: Full=Potassium-translocating ATPase A chain;AltName: Full=ATP phosphohydrolase [potassium-transporting] A chain;AltName: Full=Potassium-binding and translocating subunit A; SW:GN Name=kdpA; OrderedLocusNames=NFA_15660; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase;Ion transport; Membrane; Nucleotide-binding; Potassium;Potassium transport; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->561|ATKA_NOCFA|0.0|100.0|561/561| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006813|"GO:potassium ion transport"|Potassium transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 13 TM:REGION 4->26| TM:REGION 60->82| TM:REGION 95->117| TM:REGION 133->155| TM:REGION 175->197| TM:REGION 247->269| TM:REGION 281->303| TM:REGION 323->345| TM:REGION 351->373| TM:REGION 378->400| TM:REGION 417->439| TM:REGION 489->511| TM:REGION 531->553| SEG 12->25|asvvavlalvyvpl| SEG 138->149|vsaavgmavava| SEG 152->164|rglvrvgrggevg| SEG 298->315|ttaaesgargaaataaga| SEG 413->426|laalavlvmpalvl| SEG 465->477|asasnnngsafgg| SEG 517->547|tpatagtlptagagfaglltgtvvlvaaltf| RP:PFM:NREP 1 RP:PFM:REP 26->560|PF03814|e-100|49.2|526/555|KdpA| HM:PFM:NREP 1 HM:PFM:REP 9->561|PF03814|2.6e-204|55.7|544/555|KdpA| GO:PFM:NREP 3 GO:PFM GO:0005886|"GO:plasma membrane"|PF03814|IPR004623| GO:PFM GO:0006813|"GO:potassium ion transport"|PF03814|IPR004623| GO:PFM GO:0008556|"GO:potassium-transporting ATPase activity"|PF03814|IPR004623| OP:NHOMO 427 OP:NHOMOORG 393 OP:PATTERN ----------------1--------11----------------21----------------111---- 11111------1--11111-1---1111111-11111111-11111---11--11--2-----11-1111----------1---1---1111-1-----1-11--111-1------------------1---------------1--1--111--11------11-1322--------------11-----1--111111111111111------111-1-1-1121111111-22121111122211--11-1------------------------------------------------------------------------1--------1-1-111--1-----------------------1----2--111------121111-111111----------1-11-11111-11-11111111111111------1111---2222222221--1111--------------------------------1--1111-1111111111111111111122111111-1111-11--11--1-111--1111------------12-------11-111-1--1111---1--11-1-------11----------------33111-------------------1----1--------1------11111111111111111-11111111111111111111111111-1111111111111111111-1111--111111111111-------------1-------------------1111111-----11211211-1111-1111-111111----------------1111111111------------11----------------------------------------------1-2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 515-521| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHEEcccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccEEEEEcccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccHHHHHHHHHHcccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //