[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : kdpC
DDBJ      :kdpC         putative potassium transporter C subunit
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  254/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:214 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   32->203 PF02669 * KdpC 5e-21 45.7 %
:HMM:PFM   19->203 PF02669 * KdpC 1.8e-31 39.2 176/188  
:BLT:SWISS 103->211 ATKC_STRCO 1e-22 52.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56414.1 GT:GENE kdpC GT:PRODUCT putative potassium transporter C subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1719379..1720023 GB:FROM 1719379 GB:TO 1720023 GB:DIRECTION + GB:GENE kdpC GB:PRODUCT putative potassium transporter C subunit GB:PROTEIN_ID BAD56414.1 LENGTH 214 SQ:AASEQ MRFGTLLTNLARQTRAGAIVLLLLTAVVGAAYPAAVWAVSRIDRAAAEGAPLTDVHGCVVGSRLLAVDPVVPAGQPDPYFHPRLRGSGDDAFAPGDPAAALPTNQGPSSELLAGWIGQRRAAIAAREGVAPERVPVDAVTGSGSGVDPHISPAYAELQVPRVARVTGLGEQRVRALVAEHTAGRQAGFLGAERVEVPALNVALGLTAPGCGVGG GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 103->211|ATKC_STRCO|1e-22|52.3|109/225| TM:NTM 1 TM:REGION 17->39| SEG 16->31|agaivlllltavvgaa| SEG 86->102|gsgddafapgdpaaalp| RP:PFM:NREP 1 RP:PFM:REP 32->203|PF02669|5e-21|45.7|164/188|KdpC| HM:PFM:NREP 1 HM:PFM:REP 19->203|PF02669|1.8e-31|39.2|176/188|KdpC| GO:PFM:NREP 3 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02669|IPR003820| GO:PFM GO:0008556|"GO:potassium-transporting ATPase activity"|PF02669|IPR003820| GO:PFM GO:0016020|"GO:membrane"|PF02669|IPR003820| OP:NHOMO 272 OP:NHOMOORG 258 OP:PATTERN -------------------------11----------------1------------------------ 11111------1--11111-1---1111111-11111111-11111---11--11--1-----11-1111----------1-------1111-1-----1-11--111-1------------------1---------------1-------------------1-111---------------11-----1--111111111111111------111-1-----21111111---------------------------------------------------------------------------------------------1--------1-1-111--1-----------------------1----1--111------111111-111111----------1-11-11111-1--1111111111-111------1-11---2222222221--1111----------------------------------------111111111111111111111111-1---1111-11--11--1-111--1111------------1--------11-111-1---111---1---1---------------------------22------------------------------------1------1-1--11------------------------------111--1--1111111111111111--------1--------------------------1-------------------------1-------1--1---1-1-----------------------------1111111111------------------------------------------------------------1-2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 96-105, 211-214| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccEEEEHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccc //