[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : kdpF
DDBJ      :kdpF         putative potassium transporter F subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:32 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->32 PF09604 * Potass_KdpF 3.1e-10 68.2 22/25  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAG32222.1 GT:GENE kdpF GT:PRODUCT putative potassium transporter F subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1715531..1715629 GB:FROM 1715531 GB:TO 1715629 GB:DIRECTION + GB:GENE kdpF GB:PRODUCT putative potassium transporter F subunit GB:PROTEIN_ID BAG32222.1 LENGTH 32 SQ:AASEQ MTWAGVTSAGLVLIAAALVVYLLVALLDPERF GT:EXON 1|1-32:0| TM:NTM 1 TM:REGION 7->28| SEG 11->27|lvliaaalvvyllvall| HM:PFM:NREP 1 HM:PFM:REP 11->32|PF09604|3.1e-10|68.2|22/25|Potass_KdpF| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,32-33| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHccccc //