[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : mce1E
DDBJ      :mce1E        putative Mce family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:408 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   162->296 PF11887 * DUF3407 1e-05 31.1 %
:HMM:PFM   44->118 PF02470 * MCE 7.7e-16 28.0 75/81  
:HMM:PFM   171->291 PF11887 * DUF3407 4.5e-07 22.3 121/267  
:BLT:SWISS 139->315 SIGC_ARVS1 1e-04 23.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55386.1 GT:GENE mce1E GT:PRODUCT putative Mce family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 557436..558662 GB:FROM 557436 GB:TO 558662 GB:DIRECTION + GB:GENE mce1E GB:PRODUCT putative Mce family protein GB:PROTEIN_ID BAD55386.1 LENGTH 408 SQ:AASEQ MRRARRTATVLALGVSLTLGLTACEWDGLNSLPMPGAEGTGEGAYQIRIQMPNVTTLTANSPVRVDDVDVGSVTDIEVQDWHALVTVSLNRDVRLPANAIAKIGQTSLLGSNHVELSPPTDVVPEGQLRPGDVIPLDRAGAYPTTEEVLSSLSVVLNGGGIAQLETITKELNAALTGREDAIRDLLPQLNELTTNLRDQTGDIIAAMEGLDRFGGQLAQQRTVLETALDGIHPALTVLADRRENITRAITALGELSDVTQRVIDTSGENLKANLASLGPVLQQLADTGNNLTESLKILLTFPFPMKNLDNAIKGDYLNLFMTVDMTGKRLDTNWLTGTPLGGRFGGVEGIVGSFAPTTASDTGNPATGPIAGPTPTPSPTPTIPGLPPIPGLPAIPGLTVPLEGGQGR GT:EXON 1|1-408:0| BL:SWS:NREP 1 BL:SWS:REP 139->315|SIGC_ARVS1|1e-04|23.9|163/326| SEG 2->9|rrarrtat| SEG 341->352|ggrfggvegivg| SEG 362->399|tgnpatgpiagptptpsptptipglppipglpaipglt| RP:PFM:NREP 1 RP:PFM:REP 162->296|PF11887|1e-05|31.1|135/213|DUF3407| HM:PFM:NREP 2 HM:PFM:REP 44->118|PF02470|7.7e-16|28.0|75/81|MCE| HM:PFM:REP 171->291|PF11887|4.5e-07|22.3|121/267|DUF3407| OP:NHOMO 316 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- --------------DFD44-4L22HC66666CQFMFDAAI----------------------3-277213--------------1---------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1-----------------------------------------------------------------------------------------------------------------1----1------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 406-408| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEccccccccccEEEEEEEEEEEEEEEEEccEEEEEEEEcccEEEccccEEEEEEcccEEEEEEEEEcccccccccccccccEEEccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //