[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : mce2D
DDBJ      :mce2D        putative Mce family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:367 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->101 PF02470 * MCE 3.1e-12 28.3 60/81  
:BLT:SWISS 202->341 VG26_BPML5 1e-05 28.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55963.1 GT:GENE mce2D GT:PRODUCT putative Mce family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1244773..1245876 GB:FROM 1244773 GB:TO 1245876 GB:DIRECTION + GB:GENE mce2D GB:PRODUCT putative Mce family protein GB:PROTEIN_ID BAD55963.1 LENGTH 367 SQ:AASEQ MVKRLLGSQAFMSVAGVVVIAVVAVVGYVLAFEPLRRTESYCAIMPDSIGLYEGNQVTMRGIVVGSVTSVRNQGSGVRVDFEVDADHPVYADASATTVSDTVVADRELAVLASGATTEPWDSGACITRTLTPKSLTETLTALAQLSDELVGADPAQQNSLAAGLASLDRATADTGPQINELIRRLGSALKSPDADIAHLAGIFDAFSSVSKKVNQYWGDLETMLVRVGPVLDQATDDLLVPGAQLFDALREVLPMLDDLTSLFGTEILGLLDRTVPLLKLLRANVGSLRDIVLTTPVLASAFRTAADPETGASGLTYAPPRVALPQPAAEQVCAAVEAITPGRCAGAENGLVRVDLVSLVLGTVGAR GT:EXON 1|1-367:0| BL:SWS:NREP 1 BL:SWS:REP 202->341|VG26_BPML5|1e-05|28.9|135/100| TM:NTM 1 TM:REGION 12->34| SEG 14->31|vagvvviavvavvgyvla| HM:PFM:NREP 1 HM:PFM:REP 42->101|PF02470|3.1e-12|28.3|60/81|MCE| OP:NHOMO 94 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- --------------43311-16--7511111476967235----------------------1--12122----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 114-121| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccEEEEcEEEEEEEEEEEEccEEEEEEEEcccEEEccccEEEEEEcccEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHccc //