[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : mect
DDBJ      :mect         putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Swiss-Prot:ISPD_NOCFA   RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;         EC=2.7.7.60;AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol synthase;AltName: Full=MEP cytidylyltransferase;         Short=MCT;

Homologs  Archaea  2/68 : Bacteria  698/915 : Eukaryota  40/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->223 2px7A PDBj 3e-24 44.8 %
:RPS:PDB   9->225 3duvB PDBj 1e-15 17.0 %
:RPS:SCOP  11->227 1vpaA  c.68.1.13 * 4e-41 28.5 %
:HMM:SCOP  9->226 1w55A1 c.68.1.13 * 4.3e-56 43.4 %
:RPS:PFM   12->224 PF01128 * IspD 1e-29 46.2 %
:HMM:PFM   10->225 PF01128 * IspD 2.8e-68 44.7 215/221  
:BLT:SWISS 1->230 ISPD_NOCFA e-123 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55278.1 GT:GENE mect GT:PRODUCT putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 451069..451761 GB:FROM 451069 GB:TO 451761 GB:DIRECTION + GB:GENE mect GB:PRODUCT putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase GB:PROTEIN_ID BAD55278.1 LENGTH 230 SQ:AASEQ MNDADNDGSVVALVPAAGRGVRLGEKSPKAFVPVGGTPMVRLAVDGLLAAGVVDRIIVMVPAEWVESAVALLPPSEVVRVVVGGAERTDSVRAGLAAAPDAGYFLVHDAARALTPPALIGRIVGELRAGRRAVVPALPVVDTVKSVDAAGVVTGTPDRAALRAVQTPQGFTADLLRAAYAADVPATDDAGLVERLGEPVHTVAGDPLAFKITTPLDLRLAETLLDRRAAL GT:EXON 1|1-230:0| SW:ID ISPD_NOCFA SW:DE RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; EC=2.7.7.60;AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol synthase;AltName: Full=MEP cytidylyltransferase; Short=MCT; SW:GN Name=ispD; Synonyms=mecT; OrderedLocusNames=NFA_4360; SW:KW Complete proteome; Isoprene biosynthesis; Nucleotidyltransferase;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->230|ISPD_NOCFA|e-123|100.0|230/230| GO:SWS:NREP 3 GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 77->82|vvrvvv| BL:PDB:NREP 1 BL:PDB:REP 10->223|2px7A|3e-24|44.8|192/203| RP:PDB:NREP 1 RP:PDB:REP 9->225|3duvB|1e-15|17.0|212/249| RP:PFM:NREP 1 RP:PFM:REP 12->224|PF01128|1e-29|46.2|212/222|IspD| HM:PFM:NREP 1 HM:PFM:REP 10->225|PF01128|2.8e-68|44.7|215/221|IspD| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01128|IPR001228| GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF01128|IPR001228| RP:SCP:NREP 1 RP:SCP:REP 11->227|1vpaA|4e-41|28.5|214/221|c.68.1.13| HM:SCP:REP 9->226|1w55A1|4.3e-56|43.4|205/0|c.68.1.13|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 794 OP:NHOMOORG 740 OP:PATTERN --------------------------------2---------------------------1------- 111111111111-111111-111111111111111111111222-12121111111111122-112111211111111111211111111211411-----1---11111-------1111111111111111111-----111-11111111111111111111111111111111111111111111111111111111111111111111111111111-2122222211122222222222222-11--1----------11--------------------1--------------------------1---------111111111111112111111111111112111111111111111111--111111111111111111111111111111111111-11111111111-11111111111111111--11111-11111111111--111111111111111---------------1111-111-2111111111111111111111111111111111111111111111111-1111111111111111111111-11111111111111111111111--1---11--11-11111------------1-1--1111111111111111111111111111111--11111----111111111111111111-11111111111112112211111111-1111111111111111111111111-111111111111-111---------1111111111111111111111111111-11111111111111111111----------11111111112111111111111111111-1-----11--------11--------------------------11--111111121 ------1------------------11--------------------------------------------------------------------------------11-211--2-----1--12---121--11----2--1--------1---1-1----21---------11111311--12--1-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 99.1 SQ:SECSTR ccTTTccccEEEEEEEcccccccTcccTGGGcEETTEEHHHHHHHHHHTTTcccEEEEEEccHHHHHHHHHTTcEEEccTTcccHHHHHHHHHHHTTccTTcEEEEEcTTcTTccHHHHHHHHHHHHHHTccEEEEEEcccHHHHHcTTccccccHHHHTcccGGGccEEEHHHHHHHHHcHHHTcTTHHHHHTTccEEEEEcccccccccccHHHHHHHHHHHHTcG## DISOP:02AL 1-8| PSIPRED cccccccccEEEEEEEccccccccccccccEEEEccEEHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHccccccEEEEEEccccEEEEcccccEEEEEcHHHEEEEEccccccHHHHHHHHHcccccHHHHHHHHHccccEEEEEccHHHcccccHHHHHHHHHHHHHHHcc //