[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : murD
DDBJ      :murD         putative UDP-N-acetylmuramoylalanine-D- glutamate ligase
Swiss-Prot:MURD_NOCFA   RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;         EC=6.3.2.9;AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase;AltName: Full=D-glutamic acid-adding enzyme;

Homologs  Archaea  0/68 : Bacteria  460/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.5.1c.59.1c.72.2
:497 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->482 2jfgA PDBj 3e-14 28.9 %
:RPS:PDB   22->488 1eehA PDBj 5e-19 25.8 %
:RPS:SCOP  151->269 1j6uA3  c.72.2.1 * 4e-11 12.8 %
:RPS:SCOP  331->488 1e0dA2  c.59.1.1 * 4e-27 33.8 %
:HMM:SCOP  20->112 2uagA1 c.5.1.1 * 7.1e-14 34.8 %
:HMM:SCOP  88->157 1o5zA2 c.72.2.2 * 0.00036 24.3 %
:HMM:SCOP  130->327 2uagA3 c.72.2.1 * 3.1e-44 39.8 %
:HMM:SCOP  331->489 2uagA2 c.59.1.1 * 1.8e-32 46.7 %
:HMM:PFM   135->309 PF08245 * Mur_ligase_M 1.6e-40 46.0 163/188  
:HMM:PFM   331->397 PF02875 * Mur_ligase_C 3e-09 25.8 66/91  
:HMM:PFM   22->76 PF07991 * IlvN 0.00033 34.5 55/165  
:BLT:SWISS 18->497 MURD_NOCFA 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56610.1 GT:GENE murD GT:PRODUCT putative UDP-N-acetylmuramoylalanine-D- glutamate ligase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1919747..1921240 GB:FROM 1919747 GB:TO 1921240 GB:DIRECTION + GB:GENE murD GB:PRODUCT putative UDP-N-acetylmuramoylalanine-D- glutamate ligase GB:PROTEIN_ID BAD56610.1 LENGTH 497 SQ:AASEQ MIRMVEHSPRALRSPGPMLEFLRGRDVLVAGWGISGRSLVEPLRDIGAHPVVTDSGAKALAEAAELGLEVATSVELESADLSRFALVITSPGWRPDSPVLVSAVTEGIPVWGDVEFAWWVDQARIYGPVRKWLVVTGTNGKTTTTQMTHAILRAAGIASVACGNIGLPILDALRRNPGPQVLAVELSSFQLHWAPSVRPEAGVVLNVAEDHLDWHGGLDAYAAAKARALVGRIGVVGLDDPVAAALARRSKARRTVGFRVGVPADGELGVVDGKLLDRAFTKAAILAEVGDISPPGPAGVADALAAAALTRAIDVAPQFVKEGLQEHKVGPHRAAFVREVAGVEFIDDSKATNPHAARSSILAHPHVVWIAGGRLKGAAVEDLVEEVADRLVAAVLIGVDAPVIAAALARHAPEVPVVEVRAGDDAVMADDPLRPDEADAVMAAAVRTAAGYARAGDTVLLAPAAASLDMFADYTHRGRSFADAVHALEDGDIGRQP GT:EXON 1|1-497:0| SW:ID MURD_NOCFA SW:DE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; EC=6.3.2.9;AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase;AltName: Full=D-glutamic acid-adding enzyme; SW:GN Name=murD; OrderedLocusNames=NFA_17640; SW:KW ATP-binding; Cell cycle; Cell division; Cell shape;Cell wall biogenesis/degradation; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Peptidoglycan synthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 18->497|MURD_NOCFA|0.0|100.0|480/480| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| TM:NTM 1 TM:REGION 388->410| SEG 57->71|akalaeaaelgleva| SEG 136->148|tgtngkttttqmt| SEG 220->228|ayaaakara| SEG 243->254|aaalarrskarr| SEG 295->316|pgpagvadalaaaaltraidva| SEG 438->456|adavmaaavrtaagyarag| BL:PDB:NREP 1 BL:PDB:REP 23->482|2jfgA|3e-14|28.9|422/438| RP:PDB:NREP 1 RP:PDB:REP 22->488|1eehA|5e-19|25.8|423/431| HM:PFM:NREP 3 HM:PFM:REP 135->309|PF08245|1.6e-40|46.0|163/188|Mur_ligase_M| HM:PFM:REP 331->397|PF02875|3e-09|25.8|66/91|Mur_ligase_C| HM:PFM:REP 22->76|PF07991|0.00033|34.5|55/165|IlvN| RP:SCP:NREP 2 RP:SCP:REP 151->269|1j6uA3|4e-11|12.8|117/207|c.72.2.1| RP:SCP:REP 331->488|1e0dA2|4e-27|33.8|133/140|c.59.1.1| HM:SCP:REP 20->112|2uagA1|7.1e-14|34.8|92/93|c.5.1.1|1/1|MurCD N-terminal domain| HM:SCP:REP 88->157|1o5zA2|0.00036|24.3|70/296|c.72.2.2|1/1|MurD-like peptide ligases, catalytic domain| HM:SCP:REP 130->327|2uagA3|3.1e-44|39.8|191/204|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| HM:SCP:REP 331->489|2uagA2|1.8e-32|46.7|135/140|c.59.1.1|1/1|MurD-like peptide ligases, peptide-binding domain| OP:NHOMO 467 OP:NHOMOORG 464 OP:PATTERN -------------------------------------------------------------------- 11-1111111111111111-1111111111111111111111111111111111111111--11111111111111111--11-----111-----1---11--11-11-1111111111-----1-1-1---11-----------1-1111111---111-11111-----11----1--1------11-111111111111111111111111111111--11111111111-----------------------1----------111111-1---1111------11111111111--------------11---111111-1-------------11--11---111-11111-11--11111111--11-1--1-----111111111111111111111111-11111111-1--111111111111-11111-111111--111111111--11-11------------------------------1111-111111111111111111111111111111111-1-1---1111111-1111111111-------11111--1111----1-----1111-1---1111--11---------------------------111111111--1----111-------1-1----11-1---111----1-----------------------------------1--1---------------------------1---1----11111--1111111111-11-111---1--------1111111--11111111--1-111111-1----------1--------11---1111111111-111--1-------------------------------------------1-----1-1---1 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1--2--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 453 STR:RPRED 91.1 SQ:SECSTR #####################cTTccEEEEcccHHHHHHHHHHHTTTcccEEEEcccccTTGGGccTTccEEEccccHHHHHTccEEEEcTTccTTcHHHHHHHHTTcEEEcHHHHHHHHccccEEEEEccccHHHHHHHHccHHHHHHHHHHHTTccEEEEETTcccGGGGHHccTTccEEEEEccHHHHHTcccccccEEEEcccccccGGGcTTcHHHHHHHHHGGGccEEEEETTcGGGcccccccTTEEEEccccccEEccEEEETTEEEEEGGcEEEEETTcccGcccccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHccccccccEEEEEETTEEEEEcTTcccHHHHHTTccccccEEEEEEccccGGGTGGGGGGcccccEEEEEEcTTHHHHHTTcGGGEEEcccHHccTHHHHHHHGGGccTT###############GccTTcEEEEccccccTTTcccHHHHHHHHHHHHHHHH######## DISOP:02AL 1-17, 489-490, 492-497| PSIPRED ccccccccccccccccHHHHHHcccEEEEEEEcHHHHHHHHHHHHcccEEEEEEccccHHHHHHHcccEEEEcccccHHHccccEEEEEEccccccccHHHHHHHcccccccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccccEEEEEcccccHHHHHcccccEEEEEcccHHHHHHcccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccEEEEEEcccccccEEEEEEccEEEEEEEcccEEccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEccccEEEEEccccccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHEEEEEEcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHcccHHHHHHHHHHHHHHHHcccccccc //