[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ndk
DDBJ      :ndk          putative nucleoside diphosphate kinase
Swiss-Prot:NDK_NOCFA    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  66/68 : Bacteria  798/915 : Eukaryota  194/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:139 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->134 1k44A PDBj 5e-58 77.4 %
:RPS:PDB   2->135 2cwkB PDBj 8e-54 56.4 %
:RPS:SCOP  3->135 1b4sA  d.58.6.1 * 2e-50 54.5 %
:HMM:SCOP  1->136 2dyaA1 d.58.6.1 * 1.1e-54 62.2 %
:RPS:PFM   3->135 PF00334 * NDK 7e-43 66.7 %
:HMM:PFM   3->135 PF00334 * NDK 2.4e-57 63.6 132/135  
:BLT:SWISS 1->139 NDK_NOCFA 2e-76 100.0 %
:PROS 114->122|PS00469|NDP_KINASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56196.1 GT:GENE ndk GT:PRODUCT putative nucleoside diphosphate kinase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1514961..1515380 GB:FROM 1514961 GB:TO 1515380 GB:DIRECTION + GB:GENE ndk GB:PRODUCT putative nucleoside diphosphate kinase GB:PROTEIN_ID BAD56196.1 LENGTH 139 SQ:AASEQ MTEQTLVLIKPDGVSRGLVGEVLARIERKGLKIAALELKQVSDELAREHYAEHADKPFFGSLIEFITSGPVVAAVLEGPRAIAAFRQLAGGTDPVEKAAPGSIRGDFGLETQYNLVHGSDSPESAKREIGLWFPEFPVA GT:EXON 1|1-139:0| SW:ID NDK_NOCFA SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=NFA_13510; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->139|NDK_NOCFA|2e-76|100.0|139/139| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 114->122|PS00469|NDP_KINASES|PDOC00409| BL:PDB:NREP 1 BL:PDB:REP 2->134|1k44A|5e-58|77.4|133/135| RP:PDB:NREP 1 RP:PDB:REP 2->135|2cwkB|8e-54|56.4|133/152| RP:PFM:NREP 1 RP:PFM:REP 3->135|PF00334|7e-43|66.7|132/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 3->135|PF00334|2.4e-57|63.6|132/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 3->135|1b4sA|2e-50|54.5|132/150|d.58.6.1| HM:SCP:REP 1->136|2dyaA1|1.1e-54|62.2|135/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1680 OP:NHOMOORG 1059 OP:PATTERN 11-1111111111111-111111111111111111111111111111111111111111111111111 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111--------------111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111------11 2122334-61124451111111111111111111111111111111-1111111-111121111111111111111111111111111-111111122211136441364B8A99CA5385594BE5F7ffF-F8G4647E56EC56853726D3967799645582223713742443O22232A5881593333332 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 139 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGTccTTcHHHHHccccccccEEEcccHHHHHHHHHHHccGGGcH PSIPRED cccEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHHcccccccccccccccccEEcccccHHHHHHHHHHHccHHHcc //