[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : nuoB
DDBJ      :nuoB         putative NADH dehydrogenase I chain B
Swiss-Prot:NUOB_NOCFA   RecName: Full=NADH-quinone oxidoreductase subunit B;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B;

Homologs  Archaea  66/68 : Bacteria  602/915 : Eukaryota  140/199 : Viruses  0/175   --->[See Alignment]
e.19.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->151 3i9v6 PDBj 1e-33 61.1 %
:RPS:PDB   24->150 1e3dA PDBj 1e-22 18.1 %
:RPS:SCOP  10->153 2fug61  e.19.1.2 * 6e-38 56.7 %
:HMM:SCOP  7->167 2fug61 e.19.1.2 * 5.4e-61 52.2 %
:RPS:PFM   38->146 PF01058 * Oxidored_q6 3e-17 48.1 %
:HMM:PFM   37->146 PF01058 * Oxidored_q6 1.1e-27 38.5 109/131  
:BLT:SWISS 1->184 NUOB_NOCFA 1e-87 100.0 %
:PROS 118->134|PS01150|COMPLEX1_20K
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57513.1 GT:GENE nuoB GT:PRODUCT putative NADH dehydrogenase I chain B GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2835509..2836063) GB:FROM 2835509 GB:TO 2836063 GB:DIRECTION - GB:GENE nuoB GB:PRODUCT putative NADH dehydrogenase I chain B GB:PROTEIN_ID BAD57513.1 LENGTH 184 SQ:AASEQ MGLEEKLPSGFLLSTVESFAGYLRKGSVWPATFGLACCAIEMMATGAGRFDIARFGMEAFRASPRQADLMIVAGRVSQKMAPVLRQVYDQMAEPKWVLAMGVCASSGGMFNNYAVVQGVDHVVPVDIYLPGCPPRPEMLLNAILALHDKIQHTPLGVNRQEAVRAAEQAALAATPTIRMEGLLR GT:EXON 1|1-184:0| SW:ID NUOB_NOCFA SW:DE RecName: Full=NADH-quinone oxidoreductase subunit B; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B; SW:GN Name=nuoB; OrderedLocusNames=NFA_26660; SW:KW 4Fe-4S; Cell membrane; Complete proteome; Iron; Iron-sulfur; Membrane;Metal-binding; NAD; Oxidoreductase; Quinone; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->184|NUOB_NOCFA|1e-87|100.0|184/184| GO:SWS:NREP 9 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 118->134|PS01150|COMPLEX1_20K|PDOC00858| SEG 115->125|vvqgvdhvvpv| SEG 159->173|rqeavraaeqaalaa| BL:PDB:NREP 1 BL:PDB:REP 10->151|3i9v6|1e-33|61.1|126/145| RP:PDB:NREP 1 RP:PDB:REP 24->150|1e3dA|1e-22|18.1|127/262| RP:PFM:NREP 1 RP:PFM:REP 38->146|PF01058|3e-17|48.1|108/128|Oxidored_q6| HM:PFM:NREP 1 HM:PFM:REP 37->146|PF01058|1.1e-27|38.5|109/131|Oxidored_q6| GO:PFM:NREP 4 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF01058|IPR006137| GO:PFM GO:0048038|"GO:quinone binding"|PF01058|IPR006137| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01058|IPR006137| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01058|IPR006137| RP:SCP:NREP 1 RP:SCP:REP 10->153|2fug61|6e-38|56.7|127/144|e.19.1.2| HM:SCP:REP 7->167|2fug61|5.4e-61|52.2|161/0|e.19.1.2|1/1|HydA/Nqo6-like| OP:NHOMO 1224 OP:NHOMOORG 808 OP:PATTERN 112131212222222131122221211112111-1223222222132411233132232231121-11 22212---------12111-11--11111111111-11111111-1--1-----------22212112221--------21111211211111---1--1-11--22211--------------1111111111212222233321211211111111111111212111111111111111111111--1-1-111111111111111------111111----------11------------------------------------------------------------------------------------------1---1----------2-------1-1--2--112211----22--21---23-111111111212111112533311111111111-11111111111111113222212222111111222211122222222533-12231111111111111111111111111111111111-111111111111222211123233221131122111111111111231111111112111111111122211-1-2-1-442223-433132418333313-2122211111111111111111242333221---------------------1----11--211111111122222213332322233-3333322333323333333222211122222222222222222232222331-21111111111111111111111112--1----------------11111111111-1111111111111-1111111111111--------------11111111111111112-221111------------------------------------121111-11-251 ----111-211-1111121112222312212122221222122211-1112232-1222111111----1--111------11111---12111111111111112-1-32211111-------22-2-4I1-321----3--2------1--1--1-111-1111232121121111-----1123-31131134231 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 78.3 SQ:SECSTR ########cHHHHHHHTccTTcHccEEEEEEcccccHHHHHHHTccTTcHHHHHHTTcEEEHTcccccEEEEEccEEcTGGEHHHHHHHHGGGccEEEEEcHHHHHcGGGcEEcHHHHHGGGTcccEEEccccccHHHHHHHHHHHHTTcHc################################ DISOP:02AL 1-6, 151-171| PSIPRED cccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHccHHHHHHHccEEccccccccccEEEEEcccccccHHHHHHHHHHcccccEEEEEcccccccccccccccccccccEEcccEEEccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHccccc //