[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : nuoH
DDBJ      :nuoH         putative NADH dehydrogenase I chain H
Swiss-Prot:NUOHI_NOCFA  RecName: Full=NADH-quinone oxidoreductase subunits H/I;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunits H/I;AltName: Full=NDH-1 subunit H/I;

Homologs  Archaea  55/68 : Bacteria  600/915 : Eukaryota  154/199 : Viruses  0/175   --->[See Alignment]
b.71.1d.58.1
:597 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   438->546 2fug9 PDBj 7e-37 59.6 %
:RPS:PDB   463->544 1bluA PDBj 4e-16 20.8 %
:RPS:SCOP  165->250 1bf2A2  b.71.1.1 * 8e-12 18.6 %
:RPS:SCOP  438->547 2fug91  d.58.1.5 * 2e-31 59.1 %
:HMM:SCOP  438->553 2fug91 d.58.1.5 * 9.3e-33 31.0 %
:RPS:PFM   22->336 PF00146 * NADHdh 6e-83 53.9 %
:RPS:PFM   509->526 PF00037 * Fer4 5e-05 66.7 %
:HMM:PFM   15->339 PF00146 * NADHdh 2e-106 47.9 307/311  
:HMM:PFM   463->481 PF00037 * Fer4 1.2e-09 57.9 19/24  
:HMM:PFM   503->526 PF00037 * Fer4 7e-12 45.8 24/24  
:HMM:PFM   551->576 PF06003 * SMN 0.00064 42.3 26/264  
:BLT:SWISS 1->578 NUOHI_NOCFA 0.0 100.0 %
:PROS 465->476|PS00198|4FE4S_FER_1
:PROS 510->521|PS00198|4FE4S_FER_1
:PROS 57->72|PS00667|COMPLEX1_ND1_1
:PROS 221->234|PS00668|COMPLEX1_ND1_2
:TM
:REPEAT 2|448->492|498->538
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57507.1 GT:GENE nuoH GT:PRODUCT putative NADH dehydrogenase I chain H GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2826924..2828717) GB:FROM 2826924 GB:TO 2828717 GB:DIRECTION - GB:GENE nuoH GB:PRODUCT putative NADH dehydrogenase I chain H GB:PROTEIN_ID BAD57507.1 LENGTH 597 SQ:AASEQ MPDLSLFGHDPFWLVVAKSVFLFVYIILIPLVAVLAERKVVARMQMRVGPNRVGPFGSLQSIADGVKMAFKEDLVPAIVDKPIYLLAPVVSVIPAFMAFAVIPLGGEVSVAGNTTALQLTDMPVGVLYILAITSIGVYGIVLAGWASGSTYPLLGGLRSTAQVISYEIAMALCFAAVFLHAGTMATSGIVGAQHPTWFVFLLLPSFLIYCVSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMGTVSALATTLFLGGWSAPWPFNLIPGADAGWWGLLWFTAKVWTFMFVFVWLRGTLPRLRYDQFMRLGWQLLIPVSLLWVMLVATARLLRADGHAWATGAQVVVGVALTAAMIGLFLRAGRRPAAPPEPEPEPSGEAVFLGFPTPPVPADAHRVDNPKGGLLEPLAGFAVTAATMFKKPNTEFYPEQKVPTAPRYHGRHQLNRHPDGLEKCIGCELCAWACPADAIYVEGADNTEDERYSPGERYGRVYQINYLRCIGCGLCIEACPTRALTMTNDYELTDDNRADLIYEKDRLLAPLAPGMVAPPPAMAPGTTEADYYLGAVTGGAPAAEQPAPAGAKGGAR GT:EXON 1|1-597:0| SW:ID NUOHI_NOCFA SW:DE RecName: Full=NADH-quinone oxidoreductase subunits H/I; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunits H/I;AltName: Full=NDH-1 subunit H/I; SW:GN Name=nuoH/I; OrderedLocusNames=NFA_26600; SW:KW 4Fe-4S; Cell membrane; Complete proteome; Iron; Iron-sulfur; Membrane;Metal-binding; NAD; Oxidoreductase; Quinone; Repeat; Transmembrane;Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->578|NUOHI_NOCFA|0.0|100.0|578/597| GO:SWS:NREP 9 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 465->476|PS00198|4FE4S_FER_1|PDOC00176| PROS 510->521|PS00198|4FE4S_FER_1|PDOC00176| PROS 57->72|PS00667|COMPLEX1_ND1_1|PDOC00570| PROS 221->234|PS00668|COMPLEX1_ND1_2|PDOC00570| TM:NTM 9 TM:REGION 16->37| TM:REGION 82->104| TM:REGION 123->145| TM:REGION 167->189| TM:REGION 195->217| TM:REGION 254->276| TM:REGION 289->311| TM:REGION 321->343| TM:REGION 351->373| NREPEAT 1 REPEAT 2|448->492|498->538| SEG 372->387|ragrrpaappepepep| SEG 548->566|llaplapgmvapppamapg| SEG 579->596|ggapaaeqpapagakgga| BL:PDB:NREP 1 BL:PDB:REP 438->546|2fug9|7e-37|59.6|109/154| RP:PDB:NREP 1 RP:PDB:REP 463->544|1bluA|4e-16|20.8|72/80| RP:PFM:NREP 2 RP:PFM:REP 22->336|PF00146|6e-83|53.9|297/306|NADHdh| RP:PFM:REP 509->526|PF00037|5e-05|66.7|18/24|Fer4| HM:PFM:NREP 4 HM:PFM:REP 15->339|PF00146|2e-106|47.9|307/311|NADHdh| HM:PFM:REP 463->481|PF00037|1.2e-09|57.9|19/24|Fer4| HM:PFM:REP 503->526|PF00037|7e-12|45.8|24/24|Fer4| HM:PFM:REP 551->576|PF06003|0.00064|42.3|26/264|SMN| GO:PFM:NREP 4 GO:PFM GO:0016020|"GO:membrane"|PF00146|IPR001694| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00146|IPR001694| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00037|IPR001450| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF00037|IPR001450| RP:SCP:NREP 2 RP:SCP:REP 165->250|1bf2A2|8e-12|18.6|86/113|b.71.1.1| RP:SCP:REP 438->547|2fug91|2e-31|59.1|110/154|d.58.1.5| HM:SCP:REP 438->553|2fug91|9.3e-33|31.0|116/0|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 1780 OP:NHOMOORG 809 OP:PATTERN 11313222222222223223434122222422---1-------112-112213-53363441221-12 44424---------22322-22--22222222223212222222-2--2-----1-----55222224442--------21133433322121---2--2-22--44422--------------2221122222423333312132222222222222222222222221222222222222222222--2-2-222222222222222------212222----------22------------------------------------------------------------------------------------------1---2--------------------1--4--1-2222----33--11---45-222222222222222224644422222222222-22222222222222224442224422222222444422222222222444-22252222223222222222222222222222222222-222222222222222222222222222222222222222222222222222222222222222222242222---2---342113-44424442B444423-4232322222222222222222332322332---------------------2----22--522222222233332322333233334-3424333434333442443333322223333333333333333244322342-32222222222222222222222222--2-----1----------22222222222-2222222222222-2222222222222--------------22222222222222223-222222------------------------------------131222-22-242 ----111-----1111111-11111112111221221111111211-211-11125211111212----1--111------11111---1211211122111-213-11-2163431111-12-211213D1-423--1-41133111--1--212111--12311231-2122-2111G11-11232C1331121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 25.6 SQ:SECSTR ##########################################################################################################################################################################################################################################################################################################################################################################################################cTTcccTTccccTTTccccccccccHHHHHHHHHHHHHHHHHHTTcTTcHHHHHHHHHHHHHHHHHccTTcccccTTGGGcTTccEEEccGGGTTccEEEccEEEcGGGccTTTTTccccHHHHHcTTccEEEcTTccccHHHHHHHHHHccc################################################## DISOP:02AL 373-387, 404-406, 578-597| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccccccccHHHHHHHHHcccccEEEEEcccccccccccccccccEEEccHHHHHHHHccHHccccccEEEccccccccccHHHHcccHHHHHccccccccccccccccccccHHHHHHcccccccccccccccccccccc //