[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : pabA
DDBJ      :pabA         putative para-aminobenzoate synthase
Swiss-Prot:             

Homologs  Archaea  62/68 : Bacteria  783/915 : Eukaryota  138/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->189 1qdlB PDBj 7e-40 46.7 %
:RPS:PDB   2->163 3dkyE PDBj 7e-40 9.5 %
:RPS:SCOP  2->192 1a9xB2  c.23.16.1 * 7e-39 22.8 %
:HMM:SCOP  1->192 1qdlB_ c.23.16.1 * 2.2e-58 37.8 %
:RPS:PFM   5->191 PF00117 * GATase 5e-28 37.9 %
:HMM:PFM   4->189 PF00117 * GATase 6.3e-56 38.4 185/192  
:BLT:SWISS 3->189 TRPG_AZOBR 2e-57 56.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54919.1 GT:GENE pabA GT:PRODUCT putative para-aminobenzoate synthase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 58811..59455 GB:FROM 58811 GB:TO 59455 GB:DIRECTION + GB:GENE pabA GB:PRODUCT putative para-aminobenzoate synthase GB:PROTEIN_ID BAD54919.1 LENGTH 214 SQ:AASEQ MRVLVVDNYDSFVFNLVQYLGQLGTDAVVWRNDDQHLADLDAVAADFDGILISPGPGTPDRAGASIDLVRACARTATPLLGVCLGHQAIGEAFGATVTRAPELLHGKTSSVFHVGAGVLAGLPDPFTATRYHSLTVLEDTLPAEIEVLGRTESGIVMAMRHRELPIHGVQFHPESVLTQGGHRMLANWLGVCGSRPPEGLVEMLESEVAALVPQ GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 3->189|TRPG_AZOBR|2e-57|56.2|185/196| SEG 33->48|ddqhladldavaadfd| BL:PDB:NREP 1 BL:PDB:REP 4->189|1qdlB|7e-40|46.7|182/195| RP:PDB:NREP 1 RP:PDB:REP 2->163|3dkyE|7e-40|9.5|158/180| RP:PFM:NREP 1 RP:PFM:REP 5->191|PF00117|5e-28|37.9|182/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 4->189|PF00117|6.3e-56|38.4|185/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 2->192|1a9xB2|7e-39|22.8|180/228|c.23.16.1| HM:SCP:REP 1->192|1qdlB_|2.2e-58|37.8|188/195|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 1862 OP:NHOMOORG 983 OP:PATTERN 22-2--2222222122-11222133112222332332222222111122322222211211222--12 1111222222211121112-1211111111111111224312321111122111121211112221222142222222----23222311221222-111-111111231--------------122222211222111112222222532232222211111233356521111111111113332232-22133333323232334212221133222122343333332113333333333333334433-1----2----11-----1--1-3433333222122111111111111111111111111222212222133-23-------1-1212222221-2-23213332323112332123-112232112-----223223322132111111111111-22222222212-11111111111122221121222212111111111111-2222221-1------------------------21121212221111111211111111111111111111111111111111111221111111213312232221111-3232112212222-212211211111122231212-22222112111111112111222322213222233333433333333333331-12212-1---222222222222222222-2222222222222222222232224423332333333333333222222222-2212222122222222221223233112322221221222221222222232332214454222412222211121122222123322333333333322111111113322113-331111------------------------------------111111-111113 11----2-311-2232212111122232212222221333333111212311131121222222232211222222212222222222-24323222222232131-13-1221121--------------------------------------------------1-15141-2332J2223242342741242222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 92.5 SQ:SECSTR cHHHHHTcccEEEccccccccEEEccEEEccccccHHHHHHHHHHHHcEEcccHHHHHHHTTTccHHHHHTTccccccTTccEEETTcGGGGccccHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHTEccHHHHHHHHTTTHHHHHHHHHHHHHHHccEEEEcccTTcTTcTTHHHHHHHHHHHHHHHHHH################ DISOP:02AL 214-215| PSIPRED cEEEEEEccccHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHcccEEEEccccccccEEEEEEccccHHccccccEEEEEEccEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcc //