[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : panB
DDBJ      :panB         putative 3-methyl-2-oxobutanoate hydroxymethyltransferase
Swiss-Prot:PANB_NOCFA   RecName: Full=3-methyl-2-oxobutanoate hydroxymethyltransferase;         EC=2.1.2.11;AltName: Full=Ketopantoate hydroxymethyltransferase;         Short=KPHMT;

Homologs  Archaea  38/68 : Bacteria  696/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
c.1.12
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->281 1oy0A PDBj 9e-93 68.1 %
:RPS:PDB   15->240 3e5bA PDBj 4e-29 14.7 %
:RPS:SCOP  25->283 1m3uA  c.1.12.8 * 1e-41 46.3 %
:HMM:SCOP  20->281 1oy0A_ c.1.12.8 * 2.1e-106 56.1 %
:RPS:PFM   21->280 PF02548 * Pantoate_transf 2e-75 56.9 %
:HMM:PFM   22->279 PF02548 * Pantoate_transf 6.5e-113 55.8 258/261  
:BLT:SWISS 1->283 PANB_NOCFA e-156 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56496.1 GT:GENE panB GT:PRODUCT putative 3-methyl-2-oxobutanoate hydroxymethyltransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1799649..1800500) GB:FROM 1799649 GB:TO 1800500 GB:DIRECTION - GB:GENE panB GB:PRODUCT putative 3-methyl-2-oxobutanoate hydroxymethyltransferase GB:PROTEIN_ID BAD56496.1 LENGTH 283 SQ:AASEQ MSVSDSETPAYGAAQPAQPRRKTRIPHLRQMKADGERWAMLTAYDYSSARLFEEAGIPVLLVGDSAANVVYGYDTTVPITVDELIPLVRGVVRGAPHALVVADLPFGTYEGSAQQALAAATRFMKEGGAHAVKLEGGERVAEQIALLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGDGAEQLIADAIAVQEAGAFSVVMEMVPAELAGQVTRKLTIPTIGIGAGPDCDAQVLVWQDMAGYTSGKTAKFVKRFGDIGDQLRAAAAAYAAEVREGTFPGPEHSF GT:EXON 1|1-283:0| SW:ID PANB_NOCFA SW:DE RecName: Full=3-methyl-2-oxobutanoate hydroxymethyltransferase; EC=2.1.2.11;AltName: Full=Ketopantoate hydroxymethyltransferase; Short=KPHMT; SW:GN Name=panB; OrderedLocusNames=NFA_16500; SW:KW Complete proteome; Cytoplasm; Magnesium; Metal-binding;Methyltransferase; Pantothenate biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->283|PANB_NOCFA|e-156|100.0|283/283| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0015940|"GO:pantothenate biosynthetic process"|Pantothenate biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 262->269|aaaaayaa| BL:PDB:NREP 1 BL:PDB:REP 20->281|1oy0A|9e-93|68.1|248/248| RP:PDB:NREP 1 RP:PDB:REP 15->240|3e5bA|4e-29|14.7|211/397| RP:PFM:NREP 1 RP:PFM:REP 21->280|PF02548|2e-75|56.9|260/261|Pantoate_transf| HM:PFM:NREP 1 HM:PFM:REP 22->279|PF02548|6.5e-113|55.8|258/261|Pantoate_transf| GO:PFM:NREP 2 GO:PFM GO:0003864|"GO:3-methyl-2-oxobutanoate hydroxymethyltransferase activity"|PF02548|IPR003700| GO:PFM GO:0015940|"GO:pantothenate biosynthetic process"|PF02548|IPR003700| RP:SCP:NREP 1 RP:SCP:REP 25->283|1m3uA|1e-41|46.3|257/262|c.1.12.8| HM:SCP:REP 20->281|1oy0A_|2.1e-106|56.1|262/262|c.1.12.8|1/1|Phosphoenolpyruvate/pyruvate domain| OP:NHOMO 930 OP:NHOMOORG 856 OP:PATTERN 1111111111111111-111111-1111-111----------------------1111111-----11 11-1111111111111111-111111111111111111111111111-111111111111111-1111111---------1--1111111111111---11121111111---------------111111111111111111111111111111111111111111111111111111111111111---111111111111111111111111111111111111111111-11111111111111111111---------------------------------------------------------------------11-111111111-1111111-----1----111111211--1111-11---11111111111113-11111111111111111111-11111211121-211122222222111111-1111111111111111111-111111---------------------------111112-111121222211111111111111121111111111122111111111111111111111111111111111111111111111-111111111111111111111111111-11111111111111111111111111112222111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---111111111111211---------------1111111111212222221111211111111111111111211111111111111111111111111111-111111------------------------------------11-1111111111 ----111-----22111111111212111111111111111111111111111111111111111111-1111111111111111111-12112111111111111-111---------------------------------------------------------------1-1111I1111111-41331121222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 97.5 SQ:SECSTR #######HHHccccccccHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHTTcccEEEcHHccTTcccccccccccTTHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHccccccccccccEEEEcTTccccHHHHHHHHHHHHHTccEEEEEcccccccTcccccEEccHHHHHHHHHHHHHHHHHHTcccEEEEEEcTTTccEEccccTGGGccTTccccTTccEEccccHHHEEcccHHHHHHcHHHHHHHHHHHHHHHHTHHHTcccHHHHHHH DISOP:02AL 1-24, 278-283| PSIPRED ccccccccccccccccccccccccHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEccHHHcEEccccccccEEHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHccccEEEEccccHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHcHHEEEEccccHHHHHHHHHHccccEEEEccccccccEEEHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //