[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : phoU
DDBJ      :phoU         putative phosphate transport system regulatory protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  557/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.7.12
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->210 1t8bA PDBj 1e-20 33.0 %
:RPS:SCOP  45->210 1t72A  a.7.12.1 * 1e-40 29.3 %
:HMM:SCOP  4->215 1xwmA_ a.7.12.1 * 6.7e-50 35.2 %
:RPS:PFM   18->102 PF01895 * PhoU 2e-09 37.6 %
:RPS:PFM   123->203 PF01895 * PhoU 2e-04 32.6 %
:HMM:PFM   17->103 PF01895 * PhoU 1.9e-13 31.4 86/88  
:HMM:PFM   122->204 PF01895 * PhoU 1.4e-13 25.3 83/88  
:BLT:SWISS 1->213 PHOU2_MYCTU 3e-86 70.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55449.1 GT:GENE phoU GT:PRODUCT putative phosphate transport system regulatory protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(622300..622962) GB:FROM 622300 GB:TO 622962 GB:DIRECTION - GB:GENE phoU GB:PRODUCT putative phosphate transport system regulatory protein GB:PROTEIN_ID BAD55449.1 LENGTH 220 SQ:AASEQ MRVIYNEQMTDLARLLGEMADLAGSAMDRATQSLLQADLALAEQVISEGDRIAEMISDAEERAFALLALQAPVAGDLRQVVSAIQIVNDVNRMGALALHVAKVTRRRHPNHALPEAVNGYFAEMGRIAVSMGQGAKEVLETRDPQRAAQLNEDDEAMDDLHRHLFTLLMDREWKYGVAAAVDVTLLGRYYERFADHAVEIGRRVIFLVTGTLPPDPDVEN GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 1->213|PHOU2_MYCTU|3e-86|70.9|213/213| BL:PDB:NREP 1 BL:PDB:REP 18->210|1t8bA|1e-20|33.0|191/208| RP:PFM:NREP 2 RP:PFM:REP 18->102|PF01895|2e-09|37.6|85/89|PhoU| RP:PFM:REP 123->203|PF01895|2e-04|32.6|81/89|PhoU| HM:PFM:NREP 2 HM:PFM:REP 17->103|PF01895|1.9e-13|31.4|86/88|PhoU| HM:PFM:REP 122->204|PF01895|1.4e-13|25.3|83/88|PhoU| RP:SCP:NREP 1 RP:SCP:REP 45->210|1t72A|1e-40|29.3|164/215|a.7.12.1| HM:SCP:REP 4->215|1xwmA_|6.7e-50|35.2|210/0|a.7.12.1|1/1|PhoU-like| OP:NHOMO 678 OP:NHOMOORG 588 OP:PATTERN ------------------------21112111--1111111111111111112-1--11--------- 21-1111111111122223-42112222222221112155111111111111111111--111111211111111111----111---111---------------1-2----------------112211112-11221111131111111111---------1--111--------------111112-12-11111111111111111----111--111-11111111111111111111111111111111111111111111111-111111122221111112222222222211111111111111-11111112112121111111-111111-1112-1-121-1111111-211221111--111111111111111111111111111111111111-11111111221111111111111111--111111111-11111111112211222-----------------------------111111111111111111111111121111111-1111111111211111--1--211111111-------11111111211111122222-31111121-11111113----------------------------1111-1111-1111111-1111-1--11----111-------------------------------------------------11-----------------------------------------11---------1--11----------------------1111111111111111111111----------1111111111------111111111111--21----------------1--------------------------111-1111111- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 94.5 SQ:SECSTR ####HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccc######## DISOP:02AL 213-220| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //