[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : pntAb
DDBJ      :pntAb        putative pyridine nucleotide transhydrogenase alpha 2 subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  392/915 : Eukaryota  51/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->82 PF04956 * TrbC 0.00017 20.3 59/100  
:BLT:SWISS 4->92 PNTA_ECOLI 2e-16 44.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55859.1 GT:GENE pntAb GT:PRODUCT putative pyridine nucleotide transhydrogenase alpha 2 subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1117169..1117483 GB:FROM 1117169 GB:TO 1117483 GB:DIRECTION + GB:GENE pntAb GB:PRODUCT putative pyridine nucleotide transhydrogenase alpha 2 subunit GB:PROTEIN_ID BAD55859.1 LENGTH 104 SQ:AASEQ MYSELLANIAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIVVLGALVTLGKMEDPSIGIQIILFVALVFGTLNVVGGFVVTDRMLGMFKGKKAPAAKAGE GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 4->92|PNTA_ECOLI|2e-16|44.7|85/510| TM:NTM 3 TM:REGION 5->27| TM:REGION 34->55| TM:REGION 63->85| SEG 93->103|kgkkapaakag| HM:PFM:NREP 1 HM:PFM:REP 22->82|PF04956|0.00017|20.3|59/100|TrbC| OP:NHOMO 488 OP:NHOMOORG 445 OP:PATTERN -----------------------------1-------------1------------------------ -11-1--------111111-1111131-1111111111211-1--------1-11-------1111111---11111----11------------1---------1--1------------------------------------1112111---11111111111--111111111111111---11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------111--111--111------------1111111-1-1-211211521111-1----111111-11111111111111-111------------11---1-1--11------1-1--1---1111111211111111111111211284211----1-11--112---1----111111-11111112--1-----2---------------1111-------------------------------1111121-1--1111111111111111111---1--1------1-1111-1111111111-1111111111111111111111111111111111111111111111111111-111111111111----11111-----1112111111111111--1111111111111111-11111-1111-11----------11111111111111111----111------1-111111----------------------------------------------11- 1111111-1--------------------------------------------------------------------------------------------------12-2-1111111---1--1---262-12111111-121--1-11-1111121-121-----11------------------------1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 92-104| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //