[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : pntB
DDBJ      :pntB         putative pyridine nucleotide transhydrogenase beta subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  466/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
c.31.1
:475 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   313->472 1xltF PDBj 2e-57 63.1 %
:RPS:PDB   313->472 2bruC PDBj 3e-31 61.2 %
:RPS:SCOP  313->473 1d4oA  c.31.1.4 * 2e-23 51.6 %
:HMM:SCOP  299->475 1d4oA_ c.31.1.4 * 7e-73 61.6 %
:RPS:PFM   8->162,217->472 PF02233 * PNTB 2e-66 55.5 %
:HMM:PFM   7->472 PF02233 * PNTB 2e-185 52.4 462/464  
:BLT:SWISS 6->162,222->472 PNTB_RHORU 2e-63 55.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55860.1 GT:GENE pntB GT:PRODUCT putative pyridine nucleotide transhydrogenase beta subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1117480..1118907 GB:FROM 1117480 GB:TO 1118907 GB:DIRECTION + GB:GENE pntB GB:PRODUCT putative pyridine nucleotide transhydrogenase beta subunit GB:PROTEIN_ID BAD55860.1 LENGTH 475 SQ:AASEQ MSPMDNLVNILYIIAFALFIYGLMGLTGPKTAVRGNWIAAAGMAIAVVATLIAVRDTGNWILIVAGLVLGVVLGVPPAKYTKMTAMPQLVAAFNGVGGGTVALIAWAEFLDTSGFSAFKHGEEPTVHIIVGSLFAAIIGSISFWGSLIAFGKLQEILPGRPIGLGKLQQPLNLLLLVGSVAAAVVIGLGAADGGAAWWWMVLLLLAAGVLGLMVVLPIGGADMPVVISLLNALTGLSAAAAGLALNNTAMIVAGMIVGASGTILTNLMAKAMNRSIPAIVAGGFGGGAAAAGGGSGEQKQAKATSAADAAIQMAYANQVIVVPGYGMAVAQAQHAVKEMAALLEAKGVEVKYAIHPVAGRMPGHMNVLLAEAEVSYDAMKEMDDINGEFARTDVALVIGANDVTNPAAREDAASPIYGMPVLNVDQAKSVIVLKRSMNSGFAGIDNPLFYAEHTSMLFGDAKKSVGEVTEELKAL GT:EXON 1|1-475:0| BL:SWS:NREP 1 BL:SWS:REP 6->162,222->472|PNTB_RHORU|2e-63|55.8|406/464| TM:NTM 10 TM:REGION 7->29| TM:REGION 33->54| TM:REGION 60->77| TM:REGION 86->108| TM:REGION 132->154| TM:REGION 169->191| TM:REGION 196->218| TM:REGION 222->244| TM:REGION 248->270| TM:REGION 312->334| SEG 38->49|iaaagmaiavva| SEG 61->78|ilivaglvlgvvlgvppa| SEG 163->216|glgklqqplnllllvgsvaaavviglgaadggaawwwmvllllaagvlglmvvl| SEG 228->249|sllnaltglsaaaaglalnnta| SEG 281->296|aggfgggaaaagggsg| SEG 301->310|akatsaadaa| BL:PDB:NREP 1 BL:PDB:REP 313->472|1xltF|2e-57|63.1|160/173| RP:PDB:NREP 1 RP:PDB:REP 313->472|2bruC|3e-31|61.2|160/167| RP:PFM:NREP 1 RP:PFM:REP 8->162,217->472|PF02233|2e-66|55.5|409/463|PNTB| HM:PFM:NREP 1 HM:PFM:REP 7->472|PF02233|2e-185|52.4|462/464|PNTB| GO:PFM:NREP 2 GO:PFM GO:0008746|"GO:NAD(P) transhydrogenase activity"|PF02233|IPR004003| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02233|IPR004003| RP:SCP:NREP 1 RP:SCP:REP 313->473|1d4oA|2e-23|51.6|161/177|c.31.1.4| HM:SCP:REP 299->475|1d4oA_|7e-73|61.6|177/177|c.31.1.4|1/1|DHS-like NAD/FAD-binding domain| OP:NHOMO 702 OP:NHOMOORG 602 OP:PATTERN -----------------------------1-------------1------------------------ -1111--------111111-111113111111111111211-1--1--1--1122-------1111111--1111111---11-----------11---------1--1------------------------------------11121111--11111111111-1111111111111111---11---------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------11111-----111111111111111111111111-11111111111-211211521111111111111111111111111111111-111------------1111-11111111----11111-111-211111111111112111111121229421111211-11111121111----111111111111112--1-----2---------------1111-------------------------------1111122-1-11111111111111111111---1111------111111-1111111111-1111111111111111111111111111111111111111111111111111-111111111111----11111111111112111111111-1111111111111111111111111111111111----------11111111111121111-1--111------1-111111--------1-------------------------------------11- 1122111-1------11111111-11111211111111111111111111111111111111---------------------------1211111---1-------12-1252214111111162111292-122111-11121111-1111311122-1412111-11-112--133A---2---121--321---2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 33.9 SQ:SECSTR ########################################################################################################################################################################################################################################################################################################################HHHccEEEEEcccHHHHTTTHHHHHHHHHHHHHHccEEEEEEcccccccccTHHHHHHHHTccTTTEEEccccHHHHHHccEEEEcccGGGGcGGGTTcTTcccTTccccccTTccEEEEEcccccccccccccTTTccccEEEEcccHHHHHHHHHHHcH## DISOP:02AL 1-4, 288-300| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccEEHEEEEcccccccccccccccccccccccHHHHHHHHHHcccEEEEccHHHHHHHHccHHHHHHHHHHHcccEEEEEEEccccccccHHEEEEEEccccHHHHHHHHHHccHHccccEEEEEcccccccHHHHcccccccccccHHHHHHccEEEEEEccccccccccccccEEccccEEEEccHHHHHHHHHHHHHcc //