[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : pstC
DDBJ      :pstC         putative phosphate transporter permease protein
Swiss-Prot:             

Homologs  Archaea  57/68 : Bacteria  773/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   80->244 3dhwA PDBj 1e-07 30.2 %
:RPS:PDB   199->242 3dhwA PDBj 5e-13 35.0 %
:RPS:SCOP  63->316 2r6gG1  f.58.1.1 * 1e-14 13.4 %
:RPS:PFM   97->252 PF00528 * BPD_transp_1 6e-09 34.3 %
:HMM:PFM   103->316 PF00528 * BPD_transp_1 1.8e-20 25.6 172/185  
:BLT:SWISS 1->324 PSTC2_MYCTU e-123 72.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55446.1 GT:GENE pstC GT:PRODUCT putative phosphate transporter permease protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 619529..620503 GB:FROM 619529 GB:TO 620503 GB:DIRECTION + GB:GENE pstC GB:PRODUCT putative phosphate transporter permease protein GB:PROTEIN_ID BAD55446.1 LENGTH 324 SQ:AASEQ MPSEPNTESAPTKTRTPHSGRAETIFRSLATAAGAVIVAAIALIALFLLIRAVPSLRADTVNFFTSTEFSTSDPDNLRFGIRDLFMVTVLSSVFALVIAVPIGVGIALFLTHYAPKALARPFATLVDLLAAVPSIVFGLWGFLVLAPKIEPVQRFLNENLGWFFLFSDGNVSISGGGTIFTAGIVLAVMILPIITSVSREVFNLTPVAHIEAAQALGATKWEVVRMTVLPYGRSGVIAGSMLGLGRALGETIAVLVVLRTSAQAGSWSLFDGGYTFASKIASAASEFSSPLPTGAYIAAGFVLFALTFVVNALARLAAGGKVNG GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 1->324|PSTC2_MYCTU|e-123|72.5|324/324| TM:NTM 6 TM:REGION 29->51| TM:REGION 85->107| TM:REGION 124->146| TM:REGION 182->204| TM:REGION 240->262| TM:REGION 297->319| SEG 29->53|lataagavivaaialialfllirav| BL:PDB:NREP 1 BL:PDB:REP 80->244|3dhwA|1e-07|30.2|139/203| RP:PDB:NREP 1 RP:PDB:REP 199->242|3dhwA|5e-13|35.0|40/203| RP:PFM:NREP 1 RP:PFM:REP 97->252|PF00528|6e-09|34.3|137/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 103->316|PF00528|1.8e-20|25.6|172/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 63->316|2r6gG1|1e-14|13.4|217/284|f.58.1.1| OP:NHOMO 1597 OP:NHOMOORG 832 OP:PATTERN 221111--1111111-1-1111114444243322211-222222111121411111-11-1---2-22 12--422222221222322-2111322222221111121221221222222222222222113212123222222222-121122222222212--------2--21-1----------------22132422222222241113223314343211122112222364621111111211111112222-1224444444434444442222224441322112222222242111111111111112222211211111111111111121111111333333322244444444444222222222222222222222232231223233232222222-222322234132222531-422222222--222211222222121111111111111111111111-22222221112221131123312214-22222121111122222222222212112212222222---------------2222122221222212222221122222222222222222222-1222221221111123232-2123-------211212125221212222221221222442111112452--21111111---------2122133222211221242222222422222444222--13111------22232232222222222-2222222222222222222222332222222222222222222322222221-233333323333--21---------12232122----1111---22222222111-211111--3233312112---------13334333333222211111111111111--21------21112112--2----1---1--1----111---111-1-112-222122 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 57.1 SQ:SECSTR ###########################################################HTTTTTHHHHHHHcH#####HHHHHHHHHHHHHHHHHHTTGGGGGHHGGGGGTcccccHHHHHHHHHHHHHHccHHHHHHHcTTcTTTTTcccc######HHHHHHHHHHTTccccc##HHHHHHHHHHHHHHHHHHHHHHcHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHH################################################################### DISOP:02AL 1-23| PSIPRED cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //