[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : pstS
DDBJ      :pstS         putative phosphate transporter phosphate-binding protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  328/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:370 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->365 2z22X PDBj 1e-22 27.0 %
:RPS:PDB   49->369 2capA PDBj 2e-33 19.2 %
:RPS:SCOP  46->368 1a40A  c.94.1.1 * 3e-50 25.1 %
:HMM:SCOP  46->367 1ixhA_ c.94.1.1 * 1.1e-67 33.7 %
:HMM:PFM   55->282 PF01547 * SBP_bac_1 9.2e-18 23.5 204/314  
:BLT:SWISS 23->370 PSTS3_MYCTU e-109 56.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55445.1 GT:GENE pstS GT:PRODUCT putative phosphate transporter phosphate-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 618331..619443 GB:FROM 618331 GB:TO 619443 GB:DIRECTION + GB:GENE pstS GB:PRODUCT putative phosphate transporter phosphate-binding protein GB:PROTEIN_ID BAD55445.1 LENGTH 370 SQ:AASEQ MNFKRSSALVGALAVVAMPLAACGSDDNTSGDTSNAANSSVACGGKESLKASGASSQKNAMERFIAAYEANCDGYTLNYTSSGSGAGVNEFLGGQTDFGGSDSPLSQSKGEPAKAQERCGAPAWNLPTVFGPIAITYNIDGVTDLVLDGPTAAKIFNGTIKTWDAPEIKALNPNAQLPAAPIAVIFRSDESGTTDNFQLYLDAASGGAWGKGGGKTFNGGVGEGAKGNEGTSAAIKNTKNSITYNEWSFAKSQNLSVAQIVTSAGPEPVKLSVETAGKAIDGVKIKGEGNDLVLDTSSFYQPTVAGSYPIMMATYEIVCSKYADAATGQAVKAFLTSAVTNGQNGLEDNGYIPIPEQFKTRLTTAINAIS GT:EXON 1|1-370:0| BL:SWS:NREP 1 BL:SWS:REP 23->370|PSTS3_MYCTU|e-109|56.9|346/370| SEG 8->22|alvgalavvamplaa| SEG 170->183|alnpnaqlpaapia| SEG 206->230|ggawgkgggktfnggvgegakgneg| BL:PDB:NREP 1 BL:PDB:REP 48->365|2z22X|1e-22|27.0|300/321| RP:PDB:NREP 1 RP:PDB:REP 49->369|2capA|2e-33|19.2|313/376| HM:PFM:NREP 1 HM:PFM:REP 55->282|PF01547|9.2e-18|23.5|204/314|SBP_bac_1| RP:SCP:NREP 1 RP:SCP:REP 46->368|1a40A|3e-50|25.1|307/321|c.94.1.1| HM:SCP:REP 46->367|1ixhA_|1.1e-67|33.7|306/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 433 OP:NHOMOORG 354 OP:PATTERN 11--11--1111111-1-11-12--------------------------------1-11-1---1-11 11--111111111223422-2122412222241111121111111111111111111111--2111111121111111----1111----1-------------------------------------------------1------13311233--2-2121-2-2223212--11121--1111--11-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------1311111122111------------11111111-1--1--1----1---12-------------22222222-1121-----------------------------------1-111111111111-111111211111111-3-11211112111111121111--2---1------------11---------------432-1-4-------1-----11---------------1-111---------------------------------------------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1---------------111----1111---1-------111---------1-111--111------------------------11-1-11---1111--------------------------------------------------------1-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------1-------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 325 STR:RPRED 87.8 SQ:SECSTR #############################################ccEccEEEccTTHHHHTcTTTccTTccHHHHHHHHHHTcGGGTcccTTccccEEEEcccccHHHHHHHHHTHHHHccEEEEEEEEEEcccccccccccccEEcHHHHHHHHHTccccGGGcTTcccccccEccccccEEEEEccccHHHHHHHHHHHHHcccccccccccccGGGTcTTccTTcTTcHcTTccccEEccccHHHHcGGGGGcTTTccEEcccEEETTEEEccccccTHHHHHHHHTcccccGGGTTcccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHTcccHHHHHHTTcccccHHHHHHHHHHHTcTc DISOP:02AL 1-2, 26-47| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEccccccEEccHHHHHHHHccccccccHHHHHHcccccccccccEEEEEccccccHHHHHHHHHHHHcccHHcccccccccccccccccccHHHHHHHHHccccEEEEEHHHHHHcccccHHHHcccccccccccHHHHHHHHccccccccccccccHHHHHcccccccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHc //