[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ptpB
DDBJ      :ptpB         putative protein-tyrosine phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  100/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->99 2fekA PDBj 2e-10 39.6 %
:RPS:PDB   2->160 1d1qA PDBj 3e-23 18.7 %
:RPS:SCOP  5->99 1c0eA  c.44.1.1 * 1e-18 28.7 %
:HMM:SCOP  1->172 1phrA_ c.44.1.1 * 2e-28 38.9 %
:RPS:PFM   5->109 PF01451 * LMWPc 3e-15 42.2 %
:HMM:PFM   3->167 PF01451 * LMWPc 1.2e-22 36.5 137/140  
:BLT:SWISS 5->87 EPSP2_RALSO 3e-12 43.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56714.1 GT:GENE ptpB GT:PRODUCT putative protein-tyrosine phosphatase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2038895..2039524) GB:FROM 2038895 GB:TO 2039524 GB:DIRECTION - GB:GENE ptpB GB:PRODUCT putative protein-tyrosine phosphatase GB:PROTEIN_ID BAD56714.1 LENGTH 209 SQ:AASEQ MPMHVLFVCNGNVCRSAIAERLTRAIAVEHRLPGLTAESAGTRALVGFPIEPLAAQTLLGLGGDPEGFRARKLKPEYIDRADLVLTMTEQIRDQVAEMAFGAGSRTFTLLEAHRIAKVTGARSIADLHAARNDLSLVGRENIADPVGLSEAAFCEVGDRIAEALVPLLLALAPHEHRLRAAEHRRPGLVLAPRIPAAPPSTFLAAQRTR GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 5->87|EPSP2_RALSO|3e-12|43.6|78/145| SEG 161->186|aealvplllalaphehrlraaehrrp| BL:PDB:NREP 1 BL:PDB:REP 4->99|2fekA|2e-10|39.6|91/147| RP:PDB:NREP 1 RP:PDB:REP 2->160|1d1qA|3e-23|18.7|139/159| RP:PFM:NREP 1 RP:PFM:REP 5->109|PF01451|3e-15|42.2|102/141|LMWPc| HM:PFM:NREP 1 HM:PFM:REP 3->167|PF01451|1.2e-22|36.5|137/140|LMWPc| GO:PFM:NREP 2 GO:PFM GO:0004725|"GO:protein tyrosine phosphatase activity"|PF01451|IPR017867| GO:PFM GO:0006470|"GO:protein amino acid dephosphorylation"|PF01451|IPR017867| RP:SCP:NREP 1 RP:SCP:REP 5->99|1c0eA|1e-18|28.7|94/154|c.44.1.1| HM:SCP:REP 1->172|1phrA_|2e-28|38.9|149/0|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 105 OP:NHOMOORG 100 OP:PATTERN -------------------------------------------------------------------- -------111-----------1----------11111122---1-1-1111-111-----11---1-111-11111-1----2------------------------------------------------------------------------------------------------------------11--------------------1-----11-----------1-------------------------------------------------------------------------------------------1-----------------------------11--111----1-------1-----------------------------------------------------------------------------------------------------------------------------------2----2-------11-----11-11-------1---------1---11------------------------------------------1111-------------------------------------------------------------------------------1-111-1---11-111--1---11--11111------1-------------------1111111-----------------------------------------------11-11-11--1-------11-------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 75.6 SQ:SECSTR ccEEEEEEEcccccHHHHHHHHHHHHHHHTTcGEEEEEEEEcccTcTccccHHHHHHHHHTTccccccccccccGGGGGTccEEEEccHHHHHHHHHHccTTccEEEEGGGGcccccccccGGGcccccccc##cGGTcccccccTTccHHHHHHHHHHH################################################# DISOP:02AL 173-184| PSIPRED ccEEEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHccccccccccccccHHHHHHccEEEEEcHHHHHHHHHHcccccccEEEEEccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccEEEEccccccccHHHHHccccc //