[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ptsH
DDBJ      :ptsH         putative phosphocarrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.94.1
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->84 1opdA_ d.94.1.1 * 3.2e-15 37.8 %
:HMM:PFM   2->80 PF00381 * PTS-HPr 2e-21 43.6 78/84  
:BLT:SWISS 2->68 PTHP_STRCO 4e-08 38.8 %
:PROS 14->21|PS00369|PTS_HPR_HIS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57700.1 GT:GENE ptsH GT:PRODUCT putative phosphocarrier protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3036944..3037204) GB:FROM 3036944 GB:TO 3037204 GB:DIRECTION - GB:GENE ptsH GB:PRODUCT putative phosphocarrier protein GB:PROTEIN_ID BAD57700.1 LENGTH 86 SQ:AASEQ MMPSTTVTVGSSIGLHARPAALIAEAVAAAGVPVTLALPGGEPVDAGSSLMIMALGATHGTEVVVSSEDQPTLDKIAEMVAADLDA GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 2->68|PTHP_STRCO|4e-08|38.8|67/100| PROS 14->21|PS00369|PTS_HPR_HIS|PDOC00318| SEG 17->30|arpaaliaeavaaa| HM:PFM:NREP 1 HM:PFM:REP 2->80|PF00381|2e-21|43.6|78/84|PTS-HPr| HM:SCP:REP 2->84|1opdA_|3.2e-15|37.8|82/85|d.94.1.1|1/1|HPr-like| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -----11-111----------1---1------11111111-------1--------------11-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccEEcHHHHHHHHHHccccccEEEEEEEcHHHHHHHHHHHHHcccc //