[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : purB
DDBJ      :purB         putative adenylosuccinate lyase
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  527/915 : Eukaryota  159/199 : Viruses  0/175   --->[See Alignment]
a.127.1
:473 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->407 2j91B PDBj 3e-45 29.7 %
:RPS:PDB   11->399 1c3cA PDBj 5e-54 24.7 %
:RPS:SCOP  11->399 1c3cA  a.127.1.1 * 2e-54 24.7 %
:HMM:SCOP  9->452 1c3cA_ a.127.1.1 * 1.7e-81 31.7 %
:RPS:PFM   40->296 PF00206 * Lyase_1 1e-22 33.6 %
:HMM:PFM   64->297 PF00206 * Lyase_1 1.9e-24 27.9 226/312  
:HMM:PFM   367->450 PF10397 * ADSL_C 1.2e-16 35.1 77/81  
:BLT:SWISS 8->407 PUR8_BOVIN 5e-51 30.8 %
:PROS 277->286|PS00163|FUMARATE_LYASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55404.1 GT:GENE purB GT:PRODUCT putative adenylosuccinate lyase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 574112..575533 GB:FROM 574112 GB:TO 575533 GB:DIRECTION + GB:GENE purB GB:PRODUCT putative adenylosuccinate lyase GB:PROTEIN_ID BAD55404.1 LENGTH 473 SQ:AASEQ MSLVPNVLATRYASPELVHLWSPEHKIVLERRLWLEVLRAQSELGIDVPDGVLADYERVVDRVDLAAIAERERVTRHDVKARIEEFNALAGHEHVHKGMTSRDLTENVEQLQIRLSLEHVHAHGVAIAARLAERAAEYRALVMAGRSHNVAAQATTLGKRFASAADELLIALTRLRELIDRYPLRGIKGPMGTAQDMLDLLGGDPAKLARLEQQVARHLGFATVLTSVGQVYPRSLDHDVLSALVQVGAGPSSLAHTIRLMAGHELVTEGFQPGQVGSSAMPHKMNTRSCERVNGLQVVLRGYASMAAELAGAQWNEGDVFCSVVRRVALPDAFFAVDGMMETFLTVLAEFGAYPAVISRELDRYLPFLATTRILMAAVRAGVGRETAHEVIKEHAVAVALAMREQGREPDLLDRLAADDRLPLDRAALDAALADKSVFVGAADDQTGAVIAQVQKLVEAYPEAARYTPSPIL GT:EXON 1|1-473:0| BL:SWS:NREP 1 BL:SWS:REP 8->407|PUR8_BOVIN|5e-51|30.8|400/490| PROS 277->286|PS00163|FUMARATE_LYASES|PDOC00147| SEG 28->39|vlerrlwlevlr| SEG 126->141|aiaarlaeraaeyral| SEG 410->435|pdlldrlaaddrlpldraaldaalad| BL:PDB:NREP 1 BL:PDB:REP 8->407|2j91B|3e-45|29.7|391/463| RP:PDB:NREP 1 RP:PDB:REP 11->399|1c3cA|5e-54|24.7|372/424| RP:PFM:NREP 1 RP:PFM:REP 40->296|PF00206|1e-22|33.6|253/302|Lyase_1| HM:PFM:NREP 2 HM:PFM:REP 64->297|PF00206|1.9e-24|27.9|226/312|Lyase_1| HM:PFM:REP 367->450|PF10397|1.2e-16|35.1|77/81|ADSL_C| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00206|IPR000362| RP:SCP:NREP 1 RP:SCP:REP 11->399|1c3cA|2e-54|24.7|372/424|a.127.1.1| HM:SCP:REP 9->452|1c3cA_|1.7e-81|31.7|423/429|a.127.1.1|1/1|L-aspartase-like| OP:NHOMO 796 OP:NHOMOORG 738 OP:PATTERN --11--1111111111--111111--------111111111111111111111111111111111--1 1111111111111111111-111111111111111111211111----------------33111111111-------1111111111-----------1---1----1----------------11111111111-----111-111111111111111111111111111111111111111111111-11111111111111112111111111111111111111111111111111111111111111111111111111111112111111111111-11111111111111111111111111111111111111111-111111111111111111111-1-11111122111111111111111111111111111111111111111111111111111-11111111211111111111111111111111111111111111111111111121111111111---------------1111111111-------------------------------1------1-1---111------------------------11--111111111111111111-111111111111112222121111111111111111---------------------------------------------111---------------------------------1-11--1---------------------------------------------------------------------------------1-2222-------------111111111--------------1-----------------1111111---1-111--1----1---1--------11------1-11111111111 ------------11112111111111111111111111111111111111122212111111111111-11111111-1111111111-1212111111111-112---12-411111-11111111114C1-211111111131111111111121112311111111-112111-------------1--1-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 457 STR:RPRED 96.6 SQ:SECSTR ####ccGGGTGGccTTHHHHTcHHHHHHHHHHHHHHHHHHHHHTTcccTTHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHGGGGTTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcEEEEEETTEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHTcEEccccTTccccccGGcccccHHHHHHHHHHTHHHTTccEEcccccccccTHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTTEEcccEEccccccccTTccccHHHHHHHHHHHHHHHTHHHHHHTTTcccTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEcHHHHHHHHTTTTTGGGHHHHHHHHHHTTccHHHHHHHHHHHHHHHGGccHHHHHHHHHHHHcTTccGGGGGGccHHHHHTTcccTTcccHHHHHHHHHHHHHHHHHc############ DISOP:02AL 1-2| PSIPRED ccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc //