[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : purE
DDBJ      :purE         putative phosphoribosylaminoimidazole carboxylase catalytic subunit
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  823/915 : Eukaryota  121/199 : Viruses  0/175   --->[See Alignment]
c.23.8
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->162 1o4vA PDBj 4e-41 55.4 %
:RPS:PDB   7->160 1d7aA PDBj 7e-47 46.4 %
:RPS:SCOP  5->160 1d7aA  c.23.8.1 * 3e-51 44.9 %
:HMM:SCOP  6->166 1o4vA_ c.23.8.1 * 4.6e-63 65.2 %
:RPS:PFM   8->148 PF00731 * AIRC 1e-37 65.2 %
:HMM:PFM   6->153 PF00731 * AIRC 6.2e-72 65.5 148/150  
:BLT:SWISS 6->151 PUR6_CORAM 2e-53 69.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55846.1 GT:GENE purE GT:PRODUCT putative phosphoribosylaminoimidazole carboxylase catalytic subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1107377..1107883 GB:FROM 1107377 GB:TO 1107883 GB:DIRECTION + GB:GENE purE GB:PRODUCT putative phosphoribosylaminoimidazole carboxylase catalytic subunit GB:PROTEIN_ID BAD55846.1 LENGTH 168 SQ:AASEQ MDTAGPAVGLIMGSDSDWPTMEAAAEALAEFGVRFEVGVVSAHRTPQRMLDYARRAADRGVKVIIAGAGGAAHLPGMVASATPLPVIGVPVPLKYLDGMDSLLSIVQMPAGVPVATVSIGGARNAGLLAVRILAATDPTLRARMEQFQADLEKLVLDKDEALRTKLLG GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 6->151|PUR6_CORAM|2e-53|69.2|146/177| SEG 66->72|agaggaa| BL:PDB:NREP 1 BL:PDB:REP 6->162|1o4vA|4e-41|55.4|157/169| RP:PDB:NREP 1 RP:PDB:REP 7->160|1d7aA|7e-47|46.4|151/157| RP:PFM:NREP 1 RP:PFM:REP 8->148|PF00731|1e-37|65.2|141/148|AIRC| HM:PFM:NREP 1 HM:PFM:REP 6->153|PF00731|6.2e-72|65.5|148/150|AIRC| GO:PFM:NREP 2 GO:PFM GO:0004638|"GO:phosphoribosylaminoimidazole carboxylase activity"|PF00731|IPR000031| GO:PFM GO:0006189|"GO:'de novo' IMP biosynthetic process"|PF00731|IPR000031| RP:SCP:NREP 1 RP:SCP:REP 5->160|1d7aA|3e-51|44.9|156/161|c.23.8.1| HM:SCP:REP 6->166|1o4vA_|4.6e-63|65.2|161/0|c.23.8.1|1/1|N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)| OP:NHOMO 1030 OP:NHOMOORG 1004 OP:PATTERN --11--1111111111-111111111111111111111111111111111112111111-1111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111---------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111121211111111111111111111-1-------11111112221111111211111111111121111111-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------1---------------------------1-11111111111 ----111-----1111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111--12------------------------------------------------------------------111181111111121221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 96.4 SQ:SECSTR ###ccEccEEEEccGGGHHHHHHHHHHHHHHTccEEEEEccTTTcHHHHHHHHHTTTTTTccEEEEEEcccccHHHHcHHcccccEEEEEcccTTTTTHHHHHHHHcccTTcccEEccccHHHHHHHHHHHHHGGGcHHHHHHHHHHHHHHHHHHHTcccccHHH### DISOP:02AL 1-4| PSIPRED ccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHccccEEEccccccccccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //