[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : purM
DDBJ      :purM         putative phosphoribosylaminoimidazole synthetase
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  804/915 : Eukaryota  176/199 : Viruses  1/175   --->[See Alignment]
d.139.1d.79.4
:358 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->345 1cliA PDBj 6e-70 45.5 %
:RPS:PDB   9->343 1cliA PDBj 1e-60 42.6 %
:RPS:SCOP  9->173 1cliA1  d.79.4.1 * 6e-36 41.8 %
:RPS:SCOP  176->343 1cliA2  d.139.1.1 * 3e-33 44.6 %
:HMM:SCOP  8->173 1cliA1 d.79.4.1 * 4.9e-43 44.6 %
:HMM:SCOP  174->350 1cliA2 d.139.1.1 * 1.1e-51 44.6 %
:RPS:PFM   102->145 PF00586 * AIRS 5e-04 50.0 %
:RPS:PFM   179->342 PF02769 * AIRS_C 8e-10 39.4 %
:HMM:PFM   179->342 PF02769 * AIRS_C 4.4e-33 35.9 142/151  
:HMM:PFM   47->145 PF00586 * AIRS 4.7e-18 31.2 93/96  
:BLT:SWISS 9->339 PUR5_MYXXD 2e-80 52.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55425.1 GT:GENE purM GT:PRODUCT putative phosphoribosylaminoimidazole synthetase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 599137..600213 GB:FROM 599137 GB:TO 600213 GB:DIRECTION + GB:GENE purM GB:PRODUCT putative phosphoribosylaminoimidazole synthetase GB:PROTEIN_ID BAD55425.1 LENGTH 358 SQ:AASEQ MTEQTPTGGASYAAAGVDIEAGDRAVELFGPLAKKATRPEVQGGLGGFAGLFALKGGYREPLLAASTDGVGTKIAVAQAMDKHDTVGLDLVAMVVDDLVVCGAEPLFLQDYIAIGKVVPEKVAELVSGIAEGCVRAGCALLGGETAEHPGLMDPDDYDLSATGVGVVEADAVLGPDRVRPGDVVIAMGSSGLHSNGYSLARKVLLDIDRMSLTGHVEEFGRTLGEELLEPTRIYAKDCLALIAETDVRTFAHVTGGGLAANLARVIPAGLVAELDRGTWNPAPVFKMIAQRGRVERAEMEKTFNMGVGMVAVVAPEDVDRALAVLTARHIECWTLGTVKKAKDADAPRAELLGEHPRF GT:EXON 1|1-358:0| BL:SWS:NREP 1 BL:SWS:REP 9->339|PUR5_MYXXD|2e-80|52.6|331/345| SEG 43->57|gglggfaglfalkgg| SEG 86->100|vgldlvamvvddlvv| BL:PDB:NREP 1 BL:PDB:REP 11->345|1cliA|6e-70|45.5|332/341| RP:PDB:NREP 1 RP:PDB:REP 9->343|1cliA|1e-60|42.6|333/341| RP:PFM:NREP 2 RP:PFM:REP 102->145|PF00586|5e-04|50.0|44/97|AIRS| RP:PFM:REP 179->342|PF02769|8e-10|39.4|142/148|AIRS_C| HM:PFM:NREP 2 HM:PFM:REP 179->342|PF02769|4.4e-33|35.9|142/151|AIRS_C| HM:PFM:REP 47->145|PF00586|4.7e-18|31.2|93/96|AIRS| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00586|IPR000728| RP:SCP:NREP 2 RP:SCP:REP 9->173|1cliA1|6e-36|41.8|165/166|d.79.4.1| RP:SCP:REP 176->343|1cliA2|3e-33|44.6|166/175|d.139.1.1| HM:SCP:REP 8->173|1cliA1|4.9e-43|44.6|166/0|d.79.4.1|1/1|PurM N-terminal domain-like| HM:SCP:REP 174->350|1cliA2|1.1e-51|44.6|175/175|d.139.1.1|1/1|PurM C-terminal domain-like| OP:NHOMO 1106 OP:NHOMOORG 1041 OP:PATTERN --11--1111111111-111111111111111111111111111111111111111111-1111--11 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111-----1-----1--------1----------------111111111111111111111111111111111111111111--11111111111111111113111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111121111111---------------1111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111-1-------11111111111111111111111111111111111111-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------1---------------------------1-11111111111 ----111-----11111111111111111111111111111111111111111111111111111111111111111-1111111111-12111111111111111-12-2121214111111111111391-113-1111-11-1111-111215222253111-111163112111-8---1121321231121111 -----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 347 STR:RPRED 96.9 SQ:SECSTR ########cTTTccccccTTHHHHHHHHTHHHHHTTccTTEEccccccccEEcccTTcccEEEEEEEEEccTHHHHHHHTTccccHHHHHHHHHHHHHGGGTcEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHTcEEEEEEEEEcTTTccTTcEEEEEEEEEEEEGGGccccTTccTTcEEEEEEccccTTccHHHHHHHHHHTTcTccTTTcccccccHHHHHHccccccHHHHHHHHHHccccEEEEccTTHHHHHGGGcccTTEEEEEcGGGccccHHHHHHHHHHTccHHHHHHHccTTEEEEEEEcGGGHHHHHHHHHTTTccEEEEEEEEEccccccccEEETTcc### DISOP:02AL 1-11, 357-358| PSIPRED cccccccccccHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccccEEEEEEcccccccccHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccEEEcccEEEcccccccccEEEEEEEEEEEcccccccccccccccEEEEEccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHcccHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEcccccccEEEEEcccccc //