[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : recR
DDBJ      :recR         putative recombination and repair protein
Swiss-Prot:RECR_NOCFA   RecName: Full=Recombination protein recR;

Homologs  Archaea  0/68 : Bacteria  872/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
e.49.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->202 1vddC PDBj 9e-55 52.1 %
:RPS:PDB   1->49 3cwsC PDBj 9e-05 18.4 %
:RPS:PDB   57->202 1cy7A PDBj 4e-33 17.9 %
:RPS:SCOP  2->202 1vddA  e.49.1.1 * 1e-35 52.1 %
:HMM:SCOP  1->202 1vddA_ e.49.1.1 * 4.1e-72 51.3 %
:RPS:PFM   38->77 PF02132 * RecR 2e-06 40.0 %
:RPS:PFM   112->160 PF01751 * Toprim 2e-04 45.5 %
:HMM:PFM   38->77 PF02132 * RecR 2.8e-17 42.5 40/41  
:HMM:PFM   81->173 PF01751 * Toprim 2.8e-15 28.9 90/96  
:HMM:PFM   8->27 PF00633 * HHH 1.5e-07 55.0 20/30  
:BLT:SWISS 1->202 RECR_NOCFA e-115 100.0 %
:PROS 56->77|PS01300|RECR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55137.1 GT:GENE recR GT:PRODUCT putative recombination and repair protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 308598..309206 GB:FROM 308598 GB:TO 309206 GB:DIRECTION + GB:GENE recR GB:PRODUCT putative recombination and repair protein GB:PROTEIN_ID BAD55137.1 LENGTH 202 SQ:AASEQ MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLQVEPPEIDRLQAALQKVRDGVQFCVVCGTVSDGELCRICADPRRDRTMICVVEEPKDVQAIERTREFRGRYHVLGGALDPLSGVGPDQLRIRELLARIGNQDDGVDVAEVIIATDPNTEGEATATYLVRMLRDFPGLTVTRLASGLPMGGDLEFADELTLGRALSGRRAL GT:EXON 1|1-202:0| SW:ID RECR_NOCFA SW:DE RecName: Full=Recombination protein recR; SW:GN Name=recR; OrderedLocusNames=NFA_2950; SW:KW Complete proteome; DNA damage; DNA recombination; DNA repair;Metal-binding; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->202|RECR_NOCFA|e-115|100.0|202/202| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 56->77|PS01300|RECR|PDOC01004| BL:PDB:NREP 1 BL:PDB:REP 2->202|1vddC|9e-55|52.1|194/196| RP:PDB:NREP 2 RP:PDB:REP 1->49|3cwsC|9e-05|18.4|49/281| RP:PDB:REP 57->202|1cy7A|4e-33|17.9|140/563| RP:PFM:NREP 2 RP:PFM:REP 38->77|PF02132|2e-06|40.0|40/41|RecR| RP:PFM:REP 112->160|PF01751|2e-04|45.5|44/110|Toprim| HM:PFM:NREP 3 HM:PFM:REP 38->77|PF02132|2.8e-17|42.5|40/41|RecR| HM:PFM:REP 81->173|PF01751|2.8e-15|28.9|90/96|Toprim| HM:PFM:REP 8->27|PF00633|1.5e-07|55.0|20/30|HHH| GO:PFM:NREP 2 GO:PFM GO:0006281|"GO:DNA repair"|PF02132|IPR015967| GO:PFM GO:0006310|"GO:DNA recombination"|PF02132|IPR015967| RP:SCP:NREP 1 RP:SCP:REP 2->202|1vddA|1e-35|52.1|194/199|e.49.1.1| HM:SCP:REP 1->202|1vddA_|4.1e-72|51.3|195/199|e.49.1.1|1/1|Recombination protein RecR| OP:NHOMO 876 OP:NHOMOORG 874 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111-11111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111---1-111111---11-1-1111-111111-11111----------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 100.0 SQ:SECSTR cccccHHHHHHHHTTcTTccHHHHHHHTTTTcccHHHHHHTGGGccHHHHHHHHTTEEEEEccHHHHHHHHTTccTTEEEEEcccccEEccccccHHHHHHHTEETTTTTEEccEEcTTTHHHHHHHHHHHHTccHHHccEEEEcccccHHHHHHHHHHHHHHccccGGGEEEcccccccHHHHHHHccHHHHHHHHHHHHH DISOP:02AL 201-202| PSIPRED ccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccEEcccccccccccccccccccccccEEEEEEcHHHHHHHHHccccccEEEEEccEEccccccccccccHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHccccc //