[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ribH2
DDBJ      :ribH2        putative riboflavin synthase beta subunit
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  533/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
c.16.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->129 1xn1J PDBj 2e-43 60.0 %
:RPS:PDB   8->121 1c41A PDBj 3e-18 35.1 %
:RPS:SCOP  5->129 1di0A  c.16.1.1 * 4e-38 59.2 %
:HMM:SCOP  5->150 1ejbA_ c.16.1.1 * 8.2e-44 43.2 %
:RPS:PFM   5->111 PF00885 * DMRL_synthase 1e-18 43.9 %
:HMM:PFM   6->149 PF00885 * DMRL_synthase 3.2e-49 40.4 141/144  
:BLT:SWISS 1->153 RISB_RHOER 7e-53 61.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56510.1 GT:GENE ribH2 GT:PRODUCT putative riboflavin synthase beta subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1815361..1815825) GB:FROM 1815361 GB:TO 1815825 GB:DIRECTION - GB:GENE ribH2 GB:PRODUCT putative riboflavin synthase beta subunit GB:PROTEIN_ID BAD56510.1 LENGTH 154 SQ:AASEQ MGTTSSASVAFVRATWHSGIVGKALEGFTAEFADLGFDPAGIDVYEVPGAFEIPLHAQRLARSGRYAAIVAAALVVDGGIYRHEFVASAVIDGLMRVQLDTDVPVFSVVLTPHHFHEHREHIDYFTGHFVTKGAEAARAVATTLASLRSLPAAR GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 1->153|RISB_RHOER|7e-53|61.4|153/155| TM:NTM 1 TM:REGION 61->83| SEG 131->145|tkgaeaaravattla| BL:PDB:NREP 1 BL:PDB:REP 5->129|1xn1J|2e-43|60.0|125/147| RP:PDB:NREP 1 RP:PDB:REP 8->121|1c41A|3e-18|35.1|114/165| RP:PFM:NREP 1 RP:PFM:REP 5->111|PF00885|1e-18|43.9|107/143|DMRL_synthase| HM:PFM:NREP 1 HM:PFM:REP 6->149|PF00885|3.2e-49|40.4|141/144|DMRL_synthase| GO:PFM:NREP 2 GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF00885|IPR002180| GO:PFM GO:0009349|"GO:riboflavin synthase complex"|PF00885|IPR002180| RP:SCP:NREP 1 RP:SCP:REP 5->129|1di0A|4e-38|59.2|125/148|c.16.1.1| HM:SCP:REP 5->150|1ejbA_|8.2e-44|43.2|146/168|c.16.1.1|1/1|Lumazine synthase| OP:NHOMO 578 OP:NHOMOORG 562 OP:PATTERN -----------------------------1---------------1-----------111-------- 1-1-1---------11111-11111211111111111122---1--11----111-------1--1-111-----1-----1---111-----1-------------11-1111111-------1--111-11111-11--11111--1111--1111--111---1--11-111---1-1--11111---11-11111111111111111111111111-111-------11-1111111111111111111-----------1111----1-1-111----------11111111111-----------------------11-11111111111111111111-111--11-111-1--21-111-1-11-1----1-------111---1111111111111111----------1--1--111111111-------1----11111111111-111---------------------------------------2111-111111211111111111111211-111-1111--1--2-1-1-1111-111-1111111111111-1111111111111-11111-111--1---11--------------------1----11111-11-1--11111111111111111111--1-111------11111111111111111-111111111111111111111111---111111111111111111111111--111111111111---1111111111--111111111111111111111111-111111111122211111122211-1-11-1111111111111111--111111111-----11------------------------------------------------------- ------------111------------------1---------111----------------1-----------------------11--------------------2------------------------------------------------------------------111------11--2--1111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 83.1 SQ:SECSTR ##ccccEcEEEEEEcTTHHHHHHHHHHHHHHHHHTTccGGGEEEEEEccTTHHHHHHHHHcccccccEEEEEEEEEccccTHHHHHHHHHHHHHHHHHHHHTccEEEEEEEEccHHHHHHHHHHHHHHHH######################## DISOP:02AL 1-4, 152-154| PSIPRED cccccccEEEEEEEEccHHHHHHHHHHHHHHHHHccccHHcEEEEEEccHHHHHHHHHHHHHcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccc //