[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplC
DDBJ      :rplC         putative ribosomal protein L3
Swiss-Prot:RL3_NOCFA    RecName: Full=50S ribosomal protein L3;

Homologs  Archaea  17/68 : Bacteria  907/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
b.43.3
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->216 1vs6D PDBj 4e-60 54.9 %
:RPS:PDB   65->216 3bboF PDBj 3e-10 41.1 %
:RPS:SCOP  11->217 1vs6D1  b.43.3.2 * 2e-78 54.6 %
:HMM:SCOP  8->220 1ffkB_ b.43.3.2 * 2e-84 56.1 %
:RPS:PFM   16->212 PF00297 * Ribosomal_L3 1e-48 56.1 %
:HMM:PFM   16->212 PF00297 * Ribosomal_L3 1e-48 41.0 195/263  
:BLT:SWISS 1->221 RL3_NOCFA e-126 100.0 %
:PROS 109->132|PS00474|RIBOSOMAL_L3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55578.1 GT:GENE rplC GT:PRODUCT putative ribosomal protein L3 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 794745..795410 GB:FROM 794745 GB:TO 795410 GB:DIRECTION + GB:GENE rplC GB:PRODUCT putative ribosomal protein L3 GB:PROTEIN_ID BAD55578.1 LENGTH 221 SQ:AASEQ MTDNKNRPAAGILGTKLGMTQVFDEKNRVVPVTVIKAGPNVVTQIRTEERDGYSAVQVAFGAIDPRKVNKPVAGQFAKAGVTPRRHIAEIRVADASSFEVGQEINADVFEEGSYVDVTGTSKGKGYAGTMKRHGFRGQGASHGAQAVHRRPGSIGGCATPGRVFKGMRMAGRMGNDRVTTQNLSVHKVDAENGLLLIKGAIPGRKGGVVIVKSAVKGGAHA GT:EXON 1|1-221:0| SW:ID RL3_NOCFA SW:DE RecName: Full=50S ribosomal protein L3; SW:GN Name=rplC; OrderedLocusNames=NFA_7330; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->221|RL3_NOCFA|e-126|100.0|221/221| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 109->132|PS00474|RIBOSOMAL_L3|PDOC00385| BL:PDB:NREP 1 BL:PDB:REP 11->216|1vs6D|4e-60|54.9|206/209| RP:PDB:NREP 1 RP:PDB:REP 65->216|3bboF|3e-10|41.1|151/154| RP:PFM:NREP 1 RP:PFM:REP 16->212|PF00297|1e-48|56.1|196/196|Ribosomal_L3| HM:PFM:NREP 1 HM:PFM:REP 16->212|PF00297|1e-48|41.0|195/263|Ribosomal_L3| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00297|IPR000597| GO:PFM GO:0005622|"GO:intracellular"|PF00297|IPR000597| GO:PFM GO:0005840|"GO:ribosome"|PF00297|IPR000597| GO:PFM GO:0006412|"GO:translation"|PF00297|IPR000597| RP:SCP:NREP 1 RP:SCP:REP 11->217|1vs6D1|2e-78|54.6|207/209|b.43.3.2| HM:SCP:REP 8->220|1ffkB_|2e-84|56.1|212/337|b.43.3.2|1/1|Translation proteins| OP:NHOMO 1178 OP:NHOMOORG 1106 OP:PATTERN -----------------------1-----1-111111111111--1-------1-----------1-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111-1111111111111111111111111111112111111211111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 22--111-411-1111111111111111111111111111111111111111111111111-111111-1111111111111111111-12111111111111111-1212221121--1111-11111241-112111-1-111111111112-1111-111111-111111222122S2222232431221131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 93.2 SQ:SECSTR ##########cccccccccccccTTccccccccccccccccccccccccccccccccccccccTcccccHHHHTTcccccccccccccccccccccTTTTcccccccccccccccccccccccccccccccccccccccccccccTTTTcccccccccccTTTTTTccccccccccccccccccEEEEETTTTEEEEccccccccccccccccccc##### DISOP:02AL 1-6, 8-10, 137-150, 217-221| PSIPRED ccccccccEEEEEEEEEcccEEEcccccEEEEEEEEEccEEEEEEEcccccccEEEEEEEcccccEEEcHHHHHHHHHHccccHHEEEEEEEccccccccccEEEEEEEccccEEEEEEEEccccEEccEEEcccccccccccccccccccEEccccccccEEEcccccccccccEEEEEEEEEEEEEEccccEEEEEcccccccccEEEEEccccccccc //