[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplE
DDBJ      :rplE         putative ribosomal protein L5
Swiss-Prot:RL5_NOCFA    RecName: Full=50S ribosomal protein L5;

Homologs  Archaea  32/68 : Bacteria  912/915 : Eukaryota  81/199 : Viruses  0/175   --->[See Alignment]
d.77.1
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->186 1iq4A PDBj 6e-55 54.8 %
:RPS:PDB   9->186 3d5bG PDBj 5e-64 53.9 %
:RPS:SCOP  10->186 1iq4A  d.77.1.1 * 2e-63 54.8 %
:HMM:SCOP  7->186 1mjiA_ d.77.1.1 * 6.7e-74 56.7 %
:RPS:PFM   31->87 PF00281 * Ribosomal_L5 1e-08 50.0 %
:RPS:PFM   91->185 PF00673 * Ribosomal_L5_C 8e-33 62.1 %
:HMM:PFM   91->185 PF00673 * Ribosomal_L5_C 1.4e-42 62.1 95/95  
:HMM:PFM   31->87 PF00281 * Ribosomal_L5 1.2e-23 53.6 56/56  
:BLT:SWISS 1->187 RL5_NOCFA 3e-97 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55621.1 GT:GENE rplE GT:PRODUCT putative ribosomal protein L5 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 846715..847278 GB:FROM 846715 GB:TO 847278 GB:DIRECTION + GB:GENE rplE GB:PRODUCT putative ribosomal protein L5 GB:PROTEIN_ID BAD55621.1 LENGTH 187 SQ:AASEQ MTTTEKIQPRLKVRYREEIKDALAKEFNYANVMQIPGVVKVVVNMGVGDAARDAKLINGAVEDLALITGQKPQIRKATKSIAQFKLREGMPIGAKVTLRGDRMWEFLDRLVSIALPRIRDFRGLSPKQFDGNGNYTFGLSEQSMFHEIDVDKIDRPRGMDITVVTTATNNEEGRALLKHLGFPFKEN GT:EXON 1|1-187:0| SW:ID RL5_NOCFA SW:DE RecName: Full=50S ribosomal protein L5; SW:GN Name=rplE; OrderedLocusNames=NFA_7760; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->187|RL5_NOCFA|3e-97|100.0|187/187| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| SEG 37->48|gvvkvvvnmgvg| BL:PDB:NREP 1 BL:PDB:REP 10->186|1iq4A|6e-55|54.8|177/179| RP:PDB:NREP 1 RP:PDB:REP 9->186|3d5bG|5e-64|53.9|178/181| RP:PFM:NREP 2 RP:PFM:REP 31->87|PF00281|1e-08|50.0|56/56|Ribosomal_L5| RP:PFM:REP 91->185|PF00673|8e-33|62.1|95/95|Ribosomal_L5_C| HM:PFM:NREP 2 HM:PFM:REP 91->185|PF00673|1.4e-42|62.1|95/95|Ribosomal_L5_C| HM:PFM:REP 31->87|PF00281|1.2e-23|53.6|56/56|Ribosomal_L5| GO:PFM:NREP 8 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00281|IPR002132| GO:PFM GO:0005622|"GO:intracellular"|PF00281|IPR002132| GO:PFM GO:0005840|"GO:ribosome"|PF00281|IPR002132| GO:PFM GO:0006412|"GO:translation"|PF00281|IPR002132| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00673|IPR002132| GO:PFM GO:0005622|"GO:intracellular"|PF00673|IPR002132| GO:PFM GO:0005840|"GO:ribosome"|PF00673|IPR002132| GO:PFM GO:0006412|"GO:translation"|PF00673|IPR002132| RP:SCP:NREP 1 RP:SCP:REP 10->186|1iq4A|2e-63|54.8|177/179|d.77.1.1| HM:SCP:REP 7->186|1mjiA_|6.7e-74|56.7|180/180|d.77.1.1|1/1|Ribosomal protein L5| OP:NHOMO 1039 OP:NHOMOORG 1025 OP:PATTERN 11--111--------1--1-1-1-111111-1------------1-111-111111111--111---- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111-11111111111111111111111111111111 ------------111111111111111------1111---------1111111111111111111111-111111111-1-1111111---11111111-11-112--1------------------------------------------------------1-----------1---------2152112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 95.2 SQ:SECSTR ########cHHHHHHHTTHHHHHHHTTccccTTTcccEEEEEEEEcccTTTTcHHHHHHHHHHHHHHHTccccccccccccTTTTccccccccEEEEEcHHHHHHHHHHHHHTTTTTcTTcccccTTccccccEEccEEccGGGccccccTTccccccEEEEEEEccccHHHHHHHHHHHTccccc# DISOP:02AL 1-7, 186-187| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHccEEEEEEccccccccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEHHHHccccccccccccccEEEEEEEcccccHHHHHHHHHHccccccc //