[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplF
DDBJ      :rplF         putative ribosomal protein L6
Swiss-Prot:RL6_NOCFA    RecName: Full=50S ribosomal protein L6;

Homologs  Archaea  20/68 : Bacteria  909/915 : Eukaryota  106/199 : Viruses  0/175   --->[See Alignment]
d.141.1
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->179 3bboI PDBj 1e-48 48.9 %
:RPS:PDB   1->179 3bboI PDBj 7e-58 48.6 %
:RPS:SCOP  8->83 1rl6A1  d.141.1.1 * 3e-22 54.7 %
:RPS:SCOP  84->171 1rl6A2  d.141.1.1 * 1e-31 54.5 %
:HMM:SCOP  5->83 1ffk11 d.141.1.1 * 7.3e-21 47.4 %
:HMM:SCOP  84->172 1rl6A2 d.141.1.1 * 7.5e-30 56.2 %
:RPS:PFM   11->83 PF00347 * Ribosomal_L6 7e-06 39.7 %
:RPS:PFM   93->165 PF00347 * Ribosomal_L6 5e-04 39.5 %
:HMM:PFM   11->83 PF00347 * Ribosomal_L6 8.9e-25 46.6 73/77  
:HMM:PFM   91->165 PF00347 * Ribosomal_L6 7.7e-22 38.9 72/77  
:BLT:SWISS 1->179 RL6_NOCFA e-101 100.0 %
:PROS 155->163|PS00525|RIBOSOMAL_L6_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55634.1 GT:GENE rplF GT:PRODUCT putative ribosomal protein L6 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 856030..856569 GB:FROM 856030 GB:TO 856569 GB:DIRECTION + GB:GENE rplF GB:PRODUCT putative ribosomal protein L6 GB:PROTEIN_ID BAD55634.1 LENGTH 179 SQ:AASEQ MSRIGKKPIAVPSGVEITIDGQHVSVKGPKGTLTHTVAEPITVTRGEDGQLEVTRPNDERRNRSLHGLTRTLIANMIEGVTKGYEKKMEIFGVGYRVQAKGSNLEFALGYSHPVPVEAPEGITFAVESPTKFSVSGIDKQKVGQISAVIHGLRKPDPYKGKGIRYAGEVVRRKVGKTGK GT:EXON 1|1-179:0| SW:ID RL6_NOCFA SW:DE RecName: Full=50S ribosomal protein L6; SW:GN Name=rplF; OrderedLocusNames=NFA_7890; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->179|RL6_NOCFA|e-101|100.0|179/179| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 155->163|PS00525|RIBOSOMAL_L6_1|PDOC00454| BL:PDB:NREP 1 BL:PDB:REP 2->179|3bboI|1e-48|48.9|178/182| RP:PDB:NREP 1 RP:PDB:REP 1->179|3bboI|7e-58|48.6|179/182| RP:PFM:NREP 2 RP:PFM:REP 11->83|PF00347|7e-06|39.7|73/74|Ribosomal_L6| RP:PFM:REP 93->165|PF00347|5e-04|39.5|68/74|Ribosomal_L6| HM:PFM:NREP 2 HM:PFM:REP 11->83|PF00347|8.9e-25|46.6|73/77|Ribosomal_L6| HM:PFM:REP 91->165|PF00347|7.7e-22|38.9|72/77|Ribosomal_L6| GO:PFM:NREP 8 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00347|IPR020040| GO:PFM GO:0005840|"GO:ribosome"|PF00347|IPR020040| GO:PFM GO:0006412|"GO:translation"|PF00347|IPR020040| GO:PFM GO:0019843|"GO:rRNA binding"|PF00347|IPR020040| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00347|IPR020040| GO:PFM GO:0005840|"GO:ribosome"|PF00347|IPR020040| GO:PFM GO:0006412|"GO:translation"|PF00347|IPR020040| GO:PFM GO:0019843|"GO:rRNA binding"|PF00347|IPR020040| RP:SCP:NREP 2 RP:SCP:REP 8->83|1rl6A1|3e-22|54.7|75/75|d.141.1.1| RP:SCP:REP 84->171|1rl6A2|1e-31|54.5|88/89|d.141.1.1| HM:SCP:REP 5->83|1ffk11|7.3e-21|47.4|78/79|d.141.1.1|1/1|Ribosomal protein L6| HM:SCP:REP 84->172|1rl6A2|7.5e-30|56.2|89/89|d.141.1.1|1/1|Ribosomal protein L6| OP:NHOMO 1117 OP:NHOMOORG 1035 OP:PATTERN -----1-----------1--11--------11---------1-1111111--1-11---11---1--- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -------------1111111111111-111111111-111111111-1111111-1111---11123321311121122312221211-23212121111131121--21-----------------------------------------------------1----------11211Z111122465122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 100.0 SQ:SECSTR ccccccccccccTTccEEEcccEEEEccccccEEEEcccccEEEEcccccEEEEcccccTTHHHHHHHHTTTTTHHHHHTTTcEEEcEEcccTTccEEEcccEEEEcccccccEEEEccccEEEEcccTTccEEEEcccHHHHHHHHHTTccccccTTTccccEETTcccccccccccc DISOP:02AL 177-179| PSIPRED ccccccEEEEcccccEEEEEccEEEEEEccEEEEEEEcccEEEEEEcccEEEEEEccccHHHHHHHHHHHHHHHccEEEEccccEEEEEEEEccEEEEEEccEEEEEEcccEEEEEEcccccEEEEccccEEEEEEccHHHHHHHHHHHHHcccccccccccEEEcccEEEEccccccc //