[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplM
DDBJ      :rplM         putative ribosomal protein L13
Swiss-Prot:RL13_NOCFA   RecName: Full=50S ribosomal protein L13;

Homologs  Archaea  0/68 : Bacteria  908/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
c.21.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->142 2i2tJ PDBj 4e-45 55.6 %
:RPS:PDB   5->138 3d5bN PDBj 1e-42 47.8 %
:RPS:SCOP  1->137 1vs6J1  c.21.1.1 * 1e-56 56.9 %
:HMM:SCOP  15->142 1j3aA_ c.21.1.1 * 3.1e-44 56.9 %
:RPS:PFM   15->137 PF00572 * Ribosomal_L13 5e-37 63.4 %
:HMM:PFM   15->141 PF00572 * Ribosomal_L13 1e-53 57.5 127/128  
:BLT:SWISS 1->147 RL13_NOCFA 5e-84 100.0 %
:PROS 105->127|PS00783|RIBOSOMAL_L13

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55711.1 GT:GENE rplM GT:PRODUCT putative ribosomal protein L13 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 967324..967767 GB:FROM 967324 GB:TO 967767 GB:DIRECTION + GB:GENE rplM GB:PRODUCT putative ribosomal protein L13 GB:PROTEIN_ID BAD55711.1 LENGTH 147 SQ:AASEQ MPTYSPKAGDVTRQWYVIDATDVVLGRLAVQAANLLRGKNKPTYAPHVDGGDFVIIINAEKVAISGNKRQDKLIHHHSGHPGGLKSRTVGQVLETRPERLVEKAVKGMIPKNKLGNAIAGKLKVYAGPNHPHAAQQPVPFEIKQVAQ GT:EXON 1|1-147:0| SW:ID RL13_NOCFA SW:DE RecName: Full=50S ribosomal protein L13; SW:GN Name=rplM; OrderedLocusNames=NFA_8660; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|RL13_NOCFA|5e-84|100.0|147/147| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 105->127|PS00783|RIBOSOMAL_L13|PDOC00625| BL:PDB:NREP 1 BL:PDB:REP 1->142|2i2tJ|4e-45|55.6|142/142| RP:PDB:NREP 1 RP:PDB:REP 5->138|3d5bN|1e-42|47.8|134/137| RP:PFM:NREP 1 RP:PFM:REP 15->137|PF00572|5e-37|63.4|123/128|Ribosomal_L13| HM:PFM:NREP 1 HM:PFM:REP 15->141|PF00572|1e-53|57.5|127/128|Ribosomal_L13| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00572|IPR005822| GO:PFM GO:0005622|"GO:intracellular"|PF00572|IPR005822| GO:PFM GO:0005840|"GO:ribosome"|PF00572|IPR005822| GO:PFM GO:0006412|"GO:translation"|PF00572|IPR005822| RP:SCP:NREP 1 RP:SCP:REP 1->137|1vs6J1|1e-56|56.9|137/140|c.21.1.1| HM:SCP:REP 15->142|1j3aA_|3.1e-44|56.9|116/142|c.21.1.1|1/1|Ribosomal protein L13| OP:NHOMO 1129 OP:NHOMOORG 1071 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111121111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-1---211-111-11111111111-1111-111111111111111111111-1111111111111111-111111111111-11111111111111112-141-111-121--111111-1-121-1-11-1-1-11111-111-11---1211-1211-1111--112222M2222242541321121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 96.6 SQ:SECSTR cccccccccccccccEEEccTTccHHHHHHHHHHHHTGGGcTTccTTTcccccEEEcccTTccccccTTTTcEEEcccccTTcccEEEHHHHHHccTHHHHHHHHHHHccccHHHHHHHHTEEEcccccccccccccEEccc##### DISOP:02AL 146-147| PSIPRED cccccccHHHccEEEEEEEcccccHHHHHHHHHHHHHcccccccccccccccEEEEEEccEEEEcccHHHcEEEEEEcccccccccccHHHHHHccHHHHHHHHHHHcccccHHHHHHHHccccccccccHHHHHcccccccccccc //