[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplN
DDBJ      :rplN         putative ribosomal protein L14
Swiss-Prot:RL14_NOCFA   RecName: Full=50S ribosomal protein L14;

Homologs  Archaea  40/68 : Bacteria  908/915 : Eukaryota  66/199 : Viruses  0/175   --->[See Alignment]
b.39.1
:122 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->122 1whiA PDBj 2e-40 80.3 %
:RPS:PDB   1->122 3bboM PDBj 4e-40 51.2 %
:RPS:SCOP  1->122 1s72K  b.39.1.1 * 3e-35 33.9 %
:HMM:SCOP  1->122 1whiA_ b.39.1.1 * 2.7e-51 64.8 %
:RPS:PFM   1->122 PF00238 * Ribosomal_L14 5e-33 62.3 %
:HMM:PFM   1->122 PF00238 * Ribosomal_L14 1.6e-54 65.6 122/122  
:BLT:SWISS 1->122 RL14_NOCFA 3e-52 100.0 %
:PROS 60->86|PS00049|RIBOSOMAL_L14
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55619.1 GT:GENE rplN GT:PRODUCT putative ribosomal protein L14 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 846029..846397 GB:FROM 846029 GB:TO 846397 GB:DIRECTION + GB:GENE rplN GB:PRODUCT putative ribosomal protein L14 GB:PROTEIN_ID BAD55619.1 LENGTH 122 SQ:AASEQ MIQQESRLRVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVLIKADNDPRGTRIFGPVGRELRDKKFMKIVSLAPEVL GT:EXON 1|1-122:0| SW:ID RL14_NOCFA SW:DE RecName: Full=50S ribosomal protein L14; SW:GN Name=rplN; OrderedLocusNames=NFA_7740; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|RL14_NOCFA|3e-52|100.0|122/122| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 60->86|PS00049|RIBOSOMAL_L14|PDOC00048| SEG 52->71|vkrgdvvkavvvrtvkerrr| BL:PDB:NREP 1 BL:PDB:REP 1->122|1whiA|2e-40|80.3|122/122| RP:PDB:NREP 1 RP:PDB:REP 1->122|3bboM|4e-40|51.2|121/121| RP:PFM:NREP 1 RP:PFM:REP 1->122|PF00238|5e-33|62.3|122/122|Ribosomal_L14| HM:PFM:NREP 1 HM:PFM:REP 1->122|PF00238|1.6e-54|65.6|122/122|Ribosomal_L14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00238|IPR000218| GO:PFM GO:0005622|"GO:intracellular"|PF00238|IPR000218| GO:PFM GO:0005840|"GO:ribosome"|PF00238|IPR000218| GO:PFM GO:0006412|"GO:translation"|PF00238|IPR000218| RP:SCP:NREP 1 RP:SCP:REP 1->122|1s72K|3e-35|33.9|118/132|b.39.1.1| HM:SCP:REP 1->122|1whiA_|2.7e-51|64.8|122/122|b.39.1.1|1/1|Ribosomal protein L14| OP:NHOMO 1035 OP:NHOMOORG 1014 OP:PATTERN 1111111111111111-------111111111--1111----11-1------11111---1-11---- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------1111--1-111-111111111111-------1111-11111111-11111111----1--111------11-1-1---2------------112--1------------------------------------------------------1----------12-2-----111353132------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEcccccEEEEEEEEEccccccccccTTcEEEEEEEEEccccccccccEEEEEEEEccccEEcTTccEEcccccEEEEccTTcccccccccccccGGGTTTTcHHHHHHccccc PSIPRED ccccccEEEEEEccccEEEEEEEEEccccccccccccEEEEEEEEccccccEEEEEEEEEEEEccccccccccccEEEEcccEEEEEcccccEEEEEEEcHHHHHHHHccccEEEEcccccc //