[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplO
DDBJ      :rplO         putative ribosomal protein L15
Swiss-Prot:RL15_NOCFA   RecName: Full=50S ribosomal protein L15;

Homologs  Archaea  0/68 : Bacteria  513/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
c.12.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->141 1vs9J PDBj 6e-14 40.3 %
:RPS:PDB   3->147 3bboN PDBj 2e-19 31.0 %
:RPS:SCOP  3->145 1vs6L1  c.12.1.1 * 7e-25 35.0 %
:HMM:SCOP  6->144 2gyaJ1 c.12.1.1 * 1.4e-37 52.9 %
:RPS:PFM   49->146 PF00828 * Ribosomal_L18e 2e-08 46.9 %
:HMM:PFM   26->144 PF00828 * Ribosomal_L18e 2.1e-28 39.7 116/129  
:BLT:SWISS 1->147 RL15_NOCFA 1e-69 100.0 %
:PROS 110->140|PS00475|RIBOSOMAL_L15
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55638.1 GT:GENE rplO GT:PRODUCT putative ribosomal protein L15 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 857849..858292 GB:FROM 857849 GB:TO 858292 GB:DIRECTION + GB:GENE rplO GB:PRODUCT putative ribosomal protein L15 GB:PROTEIN_ID BAD55638.1 LENGTH 147 SQ:AASEQ MTIKLHHLRPAPGAKTDKTRVGRGEGSKGKTAGRGTKGTKARKNVPAAFEGGQMPIHMRLPKLKGFTNKFRTEYQVVNVGRIAELFPQGGTVGKAELVAAGAVRKNQLVKVLGDGEIGVAVQVTADKVTGSAKEKITAAGGTVTELA GT:EXON 1|1-147:0| SW:ID RL15_NOCFA SW:DE RecName: Full=50S ribosomal protein L15; SW:GN Name=rplO; OrderedLocusNames=NFA_7930; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|RL15_NOCFA|1e-69|100.0|147/147| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 110->140|PS00475|RIBOSOMAL_L15|PDOC00386| SEG 28->43|kgktagrgtkgtkark| BL:PDB:NREP 1 BL:PDB:REP 3->141|1vs9J|6e-14|40.3|134/147| RP:PDB:NREP 1 RP:PDB:REP 3->147|3bboN|2e-19|31.0|145/176| RP:PFM:NREP 1 RP:PFM:REP 49->146|PF00828|2e-08|46.9|96/129|Ribosomal_L18e| HM:PFM:NREP 1 HM:PFM:REP 26->144|PF00828|2.1e-28|39.7|116/129|Ribosomal_L18e| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00828|IPR000039| GO:PFM GO:0005622|"GO:intracellular"|PF00828|IPR000039| GO:PFM GO:0005840|"GO:ribosome"|PF00828|IPR000039| GO:PFM GO:0006412|"GO:translation"|PF00828|IPR000039| RP:SCP:NREP 1 RP:SCP:REP 3->145|1vs6L1|7e-25|35.0|140/144|c.12.1.1| HM:SCP:REP 6->144|2gyaJ1|1.4e-37|52.9|136/0|c.12.1.1|1/1|Ribosomal proteins L15p and L18e| OP:NHOMO 545 OP:NHOMOORG 526 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11--1111111--------------1----11111111111111111-11111111--111111111111111111-111-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111---11111111--111111111111111111111111111111111111111111111111111--1111111111111111111111111111111-11111---11-11-111111111111111111111-11111111111111111111111111---11111111-1-----------11--1--1---------------------------11111-----1111111111111-1111111111---------------1-------1------------------1-111111111111-1111111-11111-111------------------------111----1--11--1----------------------11---------------------------------------------------------------------------------------------1----1-----1-1----1------------------11----------------1---111111111----1------------------------1111111211--------111-------1--11-----1--------1111-111--11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-E11--131-2-111-----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 98.6 SQ:SECSTR ##ccccccccccccccccccccccccccccccccccccccGGGTccTTcccccccTTcccccccccccccccccccccccccccccTTTTTTTcccccccccccccccccccccccccccccccccccTGGGTTccTTTTccEEccc DISOP:02AL 9-45| PSIPRED cEEEccccccccccccccEEEcccccccccccccccccccccccccccEEEccccHHHccccccccccccccEEEEEEHHHHHHHHHcccEEcHHHHHHHccccccccEEEEEcccccccEEEEEEEEcHHHHHHHHHcccEEEEEc //