[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplP
DDBJ      :rplP         putative ribosomal protein L16
Swiss-Prot:RL16_NOCFA   RecName: Full=50S ribosomal protein L16;

Homologs  Archaea  0/68 : Bacteria  910/915 : Eukaryota  74/199 : Viruses  0/175   --->[See Alignment]
d.41.4
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->135 1vs9K PDBj 9e-46 63.0 %
:RPS:PDB   1->134 3bboO PDBj 4e-46 53.0 %
:RPS:SCOP  1->135 1vs6M1  d.41.4.2 * 3e-46 50.0 %
:HMM:SCOP  3->134 2gyaK1 d.41.4.2 * 1.1e-54 55.7 %
:RPS:PFM   4->132 PF00252 * Ribosomal_L16 4e-33 51.9 %
:HMM:PFM   4->132 PF00252 * Ribosomal_L16 6.6e-52 50.4 129/133  
:BLT:SWISS 1->138 RL16_NOCFA 2e-80 100.0 %
:PROS 59->70|PS00586|RIBOSOMAL_L16_1
:PROS 82->93|PS00701|RIBOSOMAL_L16_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55585.1 GT:GENE rplP GT:PRODUCT putative ribosomal protein L16 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 798774..799190 GB:FROM 798774 GB:TO 799190 GB:DIRECTION + GB:GENE rplP GB:PRODUCT putative ribosomal protein L16 GB:PROTEIN_ID BAD55585.1 LENGTH 138 SQ:AASEQ MLMPRKVKHRKQHHPSRTGMAKGGTSVAFGDYGIQALEPAYVTNRQIESARIAMTRHIRRGGKIWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFEMSYPNEETAREALRRAMHKLPMKCRIVTREEQF GT:EXON 1|1-138:0| SW:ID RL16_NOCFA SW:DE RecName: Full=50S ribosomal protein L16; SW:GN Name=rplP; OrderedLocusNames=NFA_7400; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->138|RL16_NOCFA|2e-80|100.0|138/138| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 59->70|PS00586|RIBOSOMAL_L16_1|PDOC00506| PROS 82->93|PS00701|RIBOSOMAL_L16_2|PDOC00506| BL:PDB:NREP 1 BL:PDB:REP 1->135|1vs9K|9e-46|63.0|135/137| RP:PDB:NREP 1 RP:PDB:REP 1->134|3bboO|4e-46|53.0|134/135| RP:PFM:NREP 1 RP:PFM:REP 4->132|PF00252|4e-33|51.9|129/130|Ribosomal_L16| HM:PFM:NREP 1 HM:PFM:REP 4->132|PF00252|6.6e-52|50.4|129/133|Ribosomal_L16| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00252|IPR016180| GO:PFM GO:0005840|"GO:ribosome"|PF00252|IPR016180| GO:PFM GO:0006412|"GO:translation"|PF00252|IPR016180| RP:SCP:NREP 1 RP:SCP:REP 1->135|1vs6M1|3e-46|50.0|134/136|d.41.4.2| HM:SCP:REP 3->134|2gyaK1|1.1e-54|55.7|131/0|d.41.4.2|1/1|Ribosomal protein L16p/L10e| OP:NHOMO 999 OP:NHOMOORG 984 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------111----11111111------111-111-11--------------------11111--1111-1111111111111-121-11111111-1112---------3-1----------------1--1----1----------1-1-----------------11211----1--12-4-13------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 99.3 SQ:SECSTR cccccccccccccccccccTTccccccccccEEEEEcccccccHHHHHHHHHHHHHTTccccccccccccccccccccccccccccccccccccccccTTcEEEEEccccTTHHHHHHHHHHHHccccEEEEccTTE# DISOP:02AL 1-2, 13-18, 81-84, 137-138| PSIPRED ccccccccEEEccccccccccccccEEEEccEEEEEEcccEEcHHHHHHHHHHHHHHHccccEEEEEEcccccEEEcHHHcccccccccccEEEEEEccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEcccc //