[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplQ
DDBJ      :rplQ         putative ribosomal protein L17
Swiss-Prot:RL17_NOCFA   RecName: Full=50S ribosomal protein L17;

Homologs  Archaea  0/68 : Bacteria  893/915 : Eukaryota  142/199 : Viruses  0/175   --->[See Alignment]
d.188.1
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->116 3bboP PDBj 1e-28 50.9 %
:RPS:PDB   1->116 3bboP PDBj 3e-42 50.0 %
:RPS:SCOP  14->116 1gd8A  d.188.1.1 * 3e-38 47.6 %
:HMM:SCOP  14->117 1gd8A_ d.188.1.1 * 4.1e-39 55.8 %
:RPS:PFM   20->116 PF01196 * Ribosomal_L17 9e-22 58.8 %
:HMM:PFM   21->116 PF01196 * Ribosomal_L17 5.3e-40 56.2 96/97  
:BLT:SWISS 1->131 RL17_NOCFA 5e-71 100.0 %
:PROS 34->56|PS01167|RIBOSOMAL_L17
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55683.1 GT:GENE rplQ GT:PRODUCT putative ribosomal protein L17 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 931395..931931 GB:FROM 931395 GB:TO 931931 GB:DIRECTION + GB:GENE rplQ GB:PRODUCT putative ribosomal protein L17 GB:PROTEIN_ID BAD55683.1 LENGTH 178 SQ:AASEQ MPKPKKGARFGGSASHQKAIFANLATALFEHGRITTTEAKAKAVRPYAEKLITKAKAGTLADRREVLKVIRNKDVVHSLFAEIGPSFEGREGGYTRITKTLPRKGDNAPMAIIELVREKTVTNEADRARRVAASKKAEEQAPAAEAEEQAPAAEAEAPAADAAAEAKADEAAEDKKDA GT:EXON 1|1-178:0| SW:ID RL17_NOCFA SW:DE RecName: Full=50S ribosomal protein L17; SW:GN Name=rplQ; OrderedLocusNames=NFA_8380; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|RL17_NOCFA|5e-71|100.0|131/178| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 34->56|PS01167|RIBOSOMAL_L17|PDOC00897| SEG 132->177|aaskkaeeqapaaeaeeqapaaeaeapaadaaaeakadeaaedkkd| BL:PDB:NREP 1 BL:PDB:REP 5->116|3bboP|1e-28|50.9|112/116| RP:PDB:NREP 1 RP:PDB:REP 1->116|3bboP|3e-42|50.0|116/116| RP:PFM:NREP 1 RP:PFM:REP 20->116|PF01196|9e-22|58.8|97/97|Ribosomal_L17| HM:PFM:NREP 1 HM:PFM:REP 21->116|PF01196|5.3e-40|56.2|96/97|Ribosomal_L17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01196|IPR000456| GO:PFM GO:0005622|"GO:intracellular"|PF01196|IPR000456| GO:PFM GO:0005840|"GO:ribosome"|PF01196|IPR000456| GO:PFM GO:0006412|"GO:translation"|PF01196|IPR000456| RP:SCP:NREP 1 RP:SCP:REP 14->116|1gd8A|3e-38|47.6|103/105|d.188.1.1| HM:SCP:REP 14->117|1gd8A_|4.1e-39|55.8|104/105|d.188.1.1|1/1|Prokaryotic ribosomal protein L17| OP:NHOMO 1090 OP:NHOMOORG 1035 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-11111111111111111111111-1111111-1-111--111111111111111111111-111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111--1111 -1--111-1----11111-111111111111-1111111111111111111----1111111---111--11-1-111111111-111--111111----12-112--31-11111-2-1-11-11111151-111-11-1111111-1-11-1-1111--------------112222I2112243441322221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 65.2 SQ:SECSTR ccTTcccccTTccGGGHHHHHHHHHHHHHHTccEEEcHHHHHHHHHHHHHHHHHHHHcTTHHHHHHHTTcccTTHHHHHTTccGGGGcccccccEEccccccccccccccEEEEEc############################################################## DISOP:02AL 1-5, 7-11, 124-178| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEEEEccccccccccccHHHHccccccHHcccccccccHHHHHHHcccccccccHHcccHHHccccc //