[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplR
DDBJ      :rplR         putative ribosomal protein L18
Swiss-Prot:RL18_NOCFA   RecName: Full=50S ribosomal protein L18;

Homologs  Archaea  0/68 : Bacteria  823/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->135 3bboQ PDBj 6e-25 48.7 %
:RPS:PDB   22->135 3bboQ PDBj 7e-26 46.5 %
:RPS:SCOP  22->135 1vs6O1  c.55.4.1 * 7e-25 35.4 %
:HMM:SCOP  39->135 1ovyA_ c.55.4.1 * 1.2e-36 51.5 %
:RPS:PFM   26->135 PF00861 * Ribosomal_L18p 2e-17 42.7 %
:HMM:PFM   23->135 PF00861 * Ribosomal_L18p 9.1e-40 44.2 113/119  
:BLT:SWISS 1->135 RL18_NOCFA 9e-65 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55635.1 GT:GENE rplR GT:PRODUCT putative ribosomal protein L18 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 856572..856979 GB:FROM 856572 GB:TO 856979 GB:DIRECTION + GB:GENE rplR GB:PRODUCT putative ribosomal protein L18 GB:PROTEIN_ID BAD55635.1 LENGTH 135 SQ:AASEQ MAQTENQKSKRIPLGKDVSTQRRLSKARRHFRLRKKIAGTTERPRLVVHRSSRHLHAQLVDDTVGKTIAAASSIEPDVRAVEGDKTAKGKKVGELIAARAKAAGVEAVVFDRGGHDYHGRIAALADAAREGGLKF GT:EXON 1|1-135:0| SW:ID RL18_NOCFA SW:DE RecName: Full=50S ribosomal protein L18; SW:GN Name=rplR; OrderedLocusNames=NFA_7900; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->135|RL18_NOCFA|9e-65|100.0|135/135| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 97->109|aarakaagveavv| BL:PDB:NREP 1 BL:PDB:REP 22->135|3bboQ|6e-25|48.7|113/122| RP:PDB:NREP 1 RP:PDB:REP 22->135|3bboQ|7e-26|46.5|114/122| RP:PFM:NREP 1 RP:PFM:REP 26->135|PF00861|2e-17|42.7|110/118|Ribosomal_L18p| HM:PFM:NREP 1 HM:PFM:REP 23->135|PF00861|9.1e-40|44.2|113/119|Ribosomal_L18p| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00861|IPR005484| GO:PFM GO:0005622|"GO:intracellular"|PF00861|IPR005484| GO:PFM GO:0005840|"GO:ribosome"|PF00861|IPR005484| GO:PFM GO:0006412|"GO:translation"|PF00861|IPR005484| RP:SCP:NREP 1 RP:SCP:REP 22->135|1vs6O1|7e-25|35.4|113/117|c.55.4.1| HM:SCP:REP 39->135|1ovyA_|1.2e-36|51.5|97/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 858 OP:NHOMOORG 841 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111-1111111111111111--111111111111111111111111111111-111111111-11111-1111111111111111111111111111111-1111111--1-------1111111111111111111--111111111111111111111111111111111----1111111-111111----1-111111111111111111111111111111111-11111111--1-11111---1------------11--111111---111--11-11111--------------1--111-111---11111111111111111-11111111111111111111111111111111111111111111111111111-111111111111-111111111111111111111111111111-111111111111111111111111111111111111111111-11111111111111111111111111111112111111111111111111-1-1-1-----111-1111111111111111-1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1111A111114132-11------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 85.2 SQ:SECSTR ####################HccccGGGTccccccGGGGcccccccEEEEccccEEEEEEccTTccEEEEEEHHHHHHHHccTTcHHHHHHHHHHcccHHHHTccccccccccccccccTTHHHHHHHTTTTccc DISOP:02AL 1-26| PSIPRED ccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEEEEEEccccEEEEEEEcccHHHcccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccc //