[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplT
DDBJ      :rplT         putative ribosomal protein L20
Swiss-Prot:RL20_NOCFA   RecName: Full=50S ribosomal protein L20;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
a.144.2
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->117 1vs6Q PDBj 5e-27 52.6 %
:RPS:PDB   1->116 3bboS PDBj 6e-32 36.2 %
:RPS:SCOP  2->117 1vs6Q1  a.144.2.1 * 4e-33 59.5 %
:HMM:SCOP  61->120 1gyzA_ a.144.2.1 * 8e-22 58.3 %
:RPS:PFM   3->109 PF00453 * Ribosomal_L20 3e-22 57.9 %
:HMM:PFM   2->108 PF00453 * Ribosomal_L20 4.7e-43 56.1 107/108  
:BLT:SWISS 1->126 RL20_NOCFA 7e-67 100.0 %
:PROS 54->70|PS00937|RIBOSOMAL_L20

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56762.1 GT:GENE rplT GT:PRODUCT putative ribosomal protein L20 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2093217..2093597 GB:FROM 2093217 GB:TO 2093597 GB:DIRECTION + GB:GENE rplT GB:PRODUCT putative ribosomal protein L20 GB:PROTEIN_ID BAD56762.1 LENGTH 126 SQ:AASEQ MARVKRAVNAQKKRRSILEASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGDFRKLWIARINAAARLNDITYNRFIQGLKAAGVEVDRKNLAELAVSDAEAFAGLVAIAKAALPQDVNAPAA GT:EXON 1|1-126:0| SW:ID RL20_NOCFA SW:DE RecName: Full=50S ribosomal protein L20; SW:GN Name=rplT; OrderedLocusNames=NFA_19160; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->126|RL20_NOCFA|7e-67|100.0|126/126| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 54->70|PS00937|RIBOSOMAL_L20|PDOC00722| BL:PDB:NREP 1 BL:PDB:REP 2->117|1vs6Q|5e-27|52.6|116/117| RP:PDB:NREP 1 RP:PDB:REP 1->116|3bboS|6e-32|36.2|116/119| RP:PFM:NREP 1 RP:PFM:REP 3->109|PF00453|3e-22|57.9|107/108|Ribosomal_L20| HM:PFM:NREP 1 HM:PFM:REP 2->108|PF00453|4.7e-43|56.1|107/108|Ribosomal_L20| GO:PFM:NREP 5 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00453|IPR005813| GO:PFM GO:0005622|"GO:intracellular"|PF00453|IPR005813| GO:PFM GO:0005840|"GO:ribosome"|PF00453|IPR005813| GO:PFM GO:0006412|"GO:translation"|PF00453|IPR005813| GO:PFM GO:0019843|"GO:rRNA binding"|PF00453|IPR005813| RP:SCP:NREP 1 RP:SCP:REP 2->117|1vs6Q1|4e-33|59.5|116/117|a.144.2.1| HM:SCP:REP 61->120|1gyzA_|8e-22|58.3|60/60|a.144.2.1|1/1|Ribosomal protein L20| OP:NHOMO 975 OP:NHOMOORG 955 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----2------------------------------------------------------------------------------------------------------111-1111--1----1-11-1-122---1---11-11---------2-1-1-------1-------22-1217111111222-14-111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 92.9 SQ:SECSTR ccccccTTHHHHHHHHHHHHcccccccTTccHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHTcccccccGGGGTTccTTTTTHHHHHHHHHc######### DISOP:02AL 117-126| PSIPRED ccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccc //