[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplU
DDBJ      :rplU         putative ribosomal protein L21
Swiss-Prot:RL21_NOCFA   RecName: Full=50S ribosomal protein L21;

Homologs  Archaea  0/68 : Bacteria  614/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.155.1
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->103 2j01V PDBj 6e-20 46.5 %
:RPS:PDB   4->102 3bboT PDBj 5e-20 31.3 %
:RPS:SCOP  4->102 1vs6R1  b.155.1.1 * 7e-24 37.4 %
:HMM:SCOP  3->104 2i2tR1 b.155.1.1 * 4.7e-28 42.2 %
:RPS:PFM   4->95 PF00829 * Ribosomal_L21p 2e-14 48.9 %
:HMM:PFM   3->96 PF00829 * Ribosomal_L21p 3.1e-34 45.7 94/96  
:BLT:SWISS 1->103 RL21_NOCFA 1e-47 100.0 %
:PROS 73->95|PS01169|RIBOSOMAL_L21
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56198.1 GT:GENE rplU GT:PRODUCT putative ribosomal protein L21 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1519607..1519918 GB:FROM 1519607 GB:TO 1519918 GB:DIRECTION + GB:GENE rplU GB:PRODUCT putative ribosomal protein L21 GB:PROTEIN_ID BAD56198.1 LENGTH 103 SQ:AASEQ MATYAIVKTGGKQYKVAVGDLVKVEKIEGEPGAAVELSPVLVVDGAELTTEAEALAKRSVTAELVEQTKGPKIRIHKFKNKTGYHKRQGHRQPLTVLKVTGIK GT:EXON 1|1-103:0| SW:ID RL21_NOCFA SW:DE RecName: Full=50S ribosomal protein L21; SW:GN Name=rplU; OrderedLocusNames=NFA_13530; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->103|RL21_NOCFA|1e-47|100.0|103/103| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 73->95|PS01169|RIBOSOMAL_L21|PDOC00899| SEG 46->56|aeltteaeala| BL:PDB:NREP 1 BL:PDB:REP 4->103|2j01V|6e-20|46.5|99/101| RP:PDB:NREP 1 RP:PDB:REP 4->102|3bboT|5e-20|31.3|99/104| RP:PFM:NREP 1 RP:PFM:REP 4->95|PF00829|2e-14|48.9|92/96|Ribosomal_L21p| HM:PFM:NREP 1 HM:PFM:REP 3->96|PF00829|3.1e-34|45.7|94/96|Ribosomal_L21p| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00829|IPR001787| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00829|IPR001787| GO:PFM GO:0005622|"GO:intracellular"|PF00829|IPR001787| GO:PFM GO:0005840|"GO:ribosome"|PF00829|IPR001787| GO:PFM GO:0006412|"GO:translation"|PF00829|IPR001787| RP:SCP:NREP 1 RP:SCP:REP 4->102|1vs6R1|7e-24|37.4|99/103|b.155.1.1| HM:SCP:REP 3->104|2i2tR1|4.7e-28|42.2|102/0|b.155.1.1|1/1|L21p-like| OP:NHOMO 618 OP:NHOMOORG 617 OP:PATTERN -------------------------------------------------------------------- 11--111111111111111-11111111111111111111111111111111111111111111111111111111111111-1-1-1--1------------1---1----------------1----------------111-1-------1-----------------------------11111--11-1111111-1-1-111-1-11111111--1111111111-1111111111111111111111----------11-------11-111---11111111111-111111111111111111111111111111-1--111----1-111------11-111111111-1-111111111-1111-1111111-11-1111111111111111111111-111111---1--111111-1111-1-1-11-11111111--------1----111----1111--111111111111111-----11111111111111111111111111-11111111111111111111111111111111111111111-11111111-1111-111-111111111111111111111-------------------------111111-1111111111111111111111111--1-111--------11-11111-111-11-1111111111111111111111111111-11-1111111111--11111111-111111111111-1-111111-----1111111111111111111111111111-111111----1----1------------111111111111111111111111--111111---------------1------1-1111-1-111-1--11-----1-1-----1-- ------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 97.1 SQ:SECSTR ###ccccccccccccccTTccccccccTTcTTcEEEcTTcccccccccccccccccccccEEEcccccccccccEEEccTTTTccEEEccccccccccccccc DISOP:02AL 103-104| PSIPRED ccEEEEEEEccEEEEEccccEEEEEccccccccEEEEEEEEEEcccccEEcccEEcccEEEEEEEEEccccEEEEEEEcccccccEEccccccEEEEEEEEEc //