[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplW
DDBJ      :rplW         putative ribosomal protein L23
Swiss-Prot:RL23_NOCFA   RecName: Full=50S ribosomal protein L23;

Homologs  Archaea  0/68 : Bacteria  538/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.12.1
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->98 2zjrQ PDBj 9e-19 47.2 %
:RPS:PDB   6->96 3bboV PDBj 2e-18 32.1 %
:RPS:SCOP  1->98 1vs6T1  d.12.1.1 * 2e-21 36.1 %
:HMM:SCOP  4->97 1n88A_ d.12.1.1 * 9.1e-28 42.9 %
:RPS:PFM   9->87 PF00276 * Ribosomal_L23 9e-14 53.2 %
:HMM:PFM   9->93 PF00276 * Ribosomal_L23 1.6e-26 45.9 85/92  
:BLT:SWISS 1->101 RL23_NOCFA 5e-54 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55580.1 GT:GENE rplW GT:PRODUCT putative ribosomal protein L23 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 796096..796401 GB:FROM 796096 GB:TO 796401 GB:DIRECTION + GB:GENE rplW GB:PRODUCT putative ribosomal protein L23 GB:PROTEIN_ID BAD55580.1 LENGTH 101 SQ:AASEQ MTTIADPRDILLAPVISEKSYGLIEEGTYTFLVHPDSNKTQIKIAVEKVFGVKVTSVNTANRQGKRKRTRFGYGKRKNTKRALVTISADSKPIEIFGGPVA GT:EXON 1|1-101:0| SW:ID RL23_NOCFA SW:DE RecName: Full=50S ribosomal protein L23; SW:GN Name=rplW; OrderedLocusNames=NFA_7350; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->101|RL23_NOCFA|5e-54|100.0|101/101| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 9->98|2zjrQ|9e-19|47.2|89/93| RP:PDB:NREP 1 RP:PDB:REP 6->96|3bboV|2e-18|32.1|78/85| RP:PFM:NREP 1 RP:PFM:REP 9->87|PF00276|9e-14|53.2|79/91|Ribosomal_L23| HM:PFM:NREP 1 HM:PFM:REP 9->93|PF00276|1.6e-26|45.9|85/92|Ribosomal_L23| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00276|IPR013025| GO:PFM GO:0005622|"GO:intracellular"|PF00276|IPR013025| GO:PFM GO:0005840|"GO:ribosome"|PF00276|IPR013025| GO:PFM GO:0006412|"GO:translation"|PF00276|IPR013025| RP:SCP:NREP 1 RP:SCP:REP 1->98|1vs6T1|2e-21|36.1|97/99|d.12.1.1| HM:SCP:REP 4->97|1n88A_|9.1e-28|42.9|91/96|d.12.1.1|1/1|Ribosomal proteins S24e, L23 and L15e| OP:NHOMO 540 OP:NHOMOORG 538 OP:PATTERN -------------------------------------------------------------------- -111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--------1111--------111-------------------11111111111111---1-1111--1111111111-1111111111-11111111-1111111-11111111111111111111111111111111111111111111111111111111-1111111-11111111--11111-111111111111111-111111111111111111111111-11111111111111111111111111111-1111-1111111111111111111111-111-1----21111111111111111111111111111-11111111111111111111111111111111----1-111111111111-11-1------------------------1-----11111-----11111111111111111111111111111111--1----1-11-11-----1---1----------11--1-1--------1-111-1111111-1---------------------------11--111-1111-1-------------11-11---11----------------------------------------------------------------------------------------------111111----1-111---------------11111-1---1111111111111111111---------1-11-1111111111---------------11-11------------111----1---1--------1--1----1-1--1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 92.1 SQ:SECSTR #####ccccccccccccHHHHHHHHTcEEccEEcTTccHHHHHHTTTTTccccEEEcccEEETTTcccccccccccccEEEccEEEcTTTcTTTHHTT### DISOP:02AL 1-4| PSIPRED ccccccHHHHHHcccccHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcccEEEEEEEEcccccEEccccccccccccEEEEEEcccccEEcccccccc //