[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rplX
DDBJ      :rplX         putative ribosomal protein L24
Swiss-Prot:RL24_NOCFA   RecName: Full=50S ribosomal protein L24;

Homologs  Archaea  0/68 : Bacteria  827/915 : Eukaryota  74/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:104 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->101 1vsaS PDBj 2e-19 49.0 %
:RPS:PDB   1->104 3bboW PDBj 2e-24 32.7 %
:RPS:SCOP  1->104 1vs6U1  b.34.5.1 * 8e-22 43.0 %
:HMM:SCOP  2->103 2gyaS1 b.34.5.1 * 2.5e-28 56.1 %
:HMM:PFM   5->36 PF00467 * KOW 3.5e-12 53.1 32/32  
:HMM:PFM   71->99 PF12353 * eIF3g 0.00058 34.5 29/126  
:BLT:SWISS 1->104 RL24_NOCFA 3e-56 100.0 %
:PROS 6->23|PS01108|RIBOSOMAL_L24

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55620.1 GT:GENE rplX GT:PRODUCT putative ribosomal protein L24 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 846399..846713 GB:FROM 846399 GB:TO 846713 GB:DIRECTION + GB:GENE rplX GB:PRODUCT putative ribosomal protein L24 GB:PROTEIN_ID BAD55620.1 LENGTH 104 SQ:AASEQ MKVHKGDTVLVISGKDKGAKGKVIQAYPKENRVLVEGVNRIKKHVANSANQRGASSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRTDENGKRVRISRRNGKDI GT:EXON 1|1-104:0| SW:ID RL24_NOCFA SW:DE RecName: Full=50S ribosomal protein L24; SW:GN Name=rplX; OrderedLocusNames=NFA_7750; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->104|RL24_NOCFA|3e-56|100.0|104/104| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 6->23|PS01108|RIBOSOMAL_L24|PDOC00852| BL:PDB:NREP 1 BL:PDB:REP 1->101|1vsaS|2e-19|49.0|98/103| RP:PDB:NREP 1 RP:PDB:REP 1->104|3bboW|2e-24|32.7|101/110| HM:PFM:NREP 2 HM:PFM:REP 5->36|PF00467|3.5e-12|53.1|32/32|KOW| HM:PFM:REP 71->99|PF12353|0.00058|34.5|29/126|eIF3g| RP:SCP:NREP 1 RP:SCP:REP 1->104|1vs6U1|8e-22|43.0|100/102|b.34.5.1| HM:SCP:REP 2->103|2gyaS1|2.5e-28|56.1|98/0|b.34.5.1|1/1|Translation proteins SH3-like domain| OP:NHOMO 939 OP:NHOMOORG 901 OP:PATTERN -------------------------------------------------------------------- -111111111111111111-1111111111111111111111111111111111111111111111111111111111111111----111111111--111111111111111111--111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-1-11-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111-1111111121111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-----111--1111-1111111111-1---11111111111111111111111111111111111111111111-111111111111111111-------1111-1-11-111111111111111111111111-111111-1111111-1-------11--1111111111111111111111111111111111-11111-1-11111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1111111-1111111111111111111111111111111111111111111111111111111111111--------------111111111111111111111211111111111111--1--1--1111---11111111111111111111-- 21---1--1----------------------------------------------------------------------------------------------1-1---1211111-1121111--11-342-11111-111111-11-11--11-111--111-1-111---111212F121113332-22-1-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 100.0 SQ:SECSTR ccccccccEEEcccccTTcccccccccccccccccccccccccccEETcccccccccccccccccccGGGEEEccccccccccccccccccccccccccccccc DISOP:02AL 47-58| PSIPRED cEEEEccEEEEEEccccccEEEEEEEEccccEEEEEcccEEEEEEcccccccccccccEEEEEcccccccEEEEcccccccEEEEEEEEcccEEEEEEcccccc //