[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpmA
DDBJ      :rpmA         putative ribosomal protein L27
Swiss-Prot:RL27_NOCFA   RecName: Full=50S ribosomal protein L27;

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
b.84.4
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->75 2j010 PDBj 2e-24 70.3 %
:RPS:PDB   2->86 3bboX PDBj 1e-23 54.1 %
:RPS:SCOP  2->82 1vs6W1  b.84.4.1 * 8e-26 63.0 %
:HMM:SCOP  20->85 1v8qA_ b.84.4.1 * 1.4e-20 57.6 %
:RPS:PFM   2->81 PF01016 * Ribosomal_L27 6e-18 67.5 %
:HMM:PFM   2->81 PF01016 * Ribosomal_L27 9.2e-39 65.0 80/81  
:BLT:SWISS 1->88 RL27_NOCFA 2e-47 100.0 %
:PROS 34->48|PS00831|RIBOSOMAL_L27

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56199.1 GT:GENE rpmA GT:PRODUCT putative ribosomal protein L27 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1519941..1520207 GB:FROM 1519941 GB:TO 1520207 GB:DIRECTION + GB:GENE rpmA GB:PRODUCT putative ribosomal protein L27 GB:PROTEIN_ID BAD56199.1 LENGTH 88 SQ:AASEQ MAHKKGASSSRNGRDSNAQRLGVKRFGGQTVKAGEILVRQRGTHFHPGVNVGRGGDDTLFALAAGAVQFGTKRGRKTVNIVAPAPVQA GT:EXON 1|1-88:0| SW:ID RL27_NOCFA SW:DE RecName: Full=50S ribosomal protein L27; SW:GN Name=rpmA; OrderedLocusNames=NFA_13540; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|RL27_NOCFA|2e-47|100.0|88/88| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 34->48|PS00831|RIBOSOMAL_L27|PDOC00652| BL:PDB:NREP 1 BL:PDB:REP 1->75|2j010|2e-24|70.3|74/85| RP:PDB:NREP 1 RP:PDB:REP 2->86|3bboX|1e-23|54.1|85/86| RP:PFM:NREP 1 RP:PFM:REP 2->81|PF01016|6e-18|67.5|80/81|Ribosomal_L27| HM:PFM:NREP 1 HM:PFM:REP 2->81|PF01016|9.2e-39|65.0|80/81|Ribosomal_L27| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01016|IPR001684| GO:PFM GO:0005622|"GO:intracellular"|PF01016|IPR001684| GO:PFM GO:0005840|"GO:ribosome"|PF01016|IPR001684| GO:PFM GO:0006412|"GO:translation"|PF01016|IPR001684| RP:SCP:NREP 1 RP:SCP:REP 2->82|1vs6W1|8e-26|63.0|81/84|b.84.4.1| HM:SCP:REP 20->85|1v8qA_|1.4e-20|57.6|66/66|b.84.4.1|1/1|Ribosomal L27 protein| OP:NHOMO 1031 OP:NHOMOORG 990 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11--111-1-----1----1111-1--------111-----11--------------------1111111111111111111111111-12--1111-11--1112-121-1-1-------------1---------------------------------------------112222D333223431-4211211-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 98.9 SQ:SECSTR ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccE# DISOP:02AL 1-20, 86-88| PSIPRED ccEEcccccccccccccccEEEEEEccccEEccccEEEEccccEEccccEEEEccccEEEEccccEEEEEEccccEEEEEEccccccc //