[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpmC
DDBJ      :rpmC         putative ribosomal protein L29
Swiss-Prot:RL29_NOCFA   RecName: Full=50S ribosomal protein L29;

Homologs  Archaea  0/68 : Bacteria  78/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.2
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->68 1r73A PDBj 3e-08 54.1 %
:RPS:PDB   30->66 3bboZ PDBj 3e-12 35.1 %
:RPS:SCOP  30->67 1vs6X1  a.2.2.1 * 2e-12 42.1 %
:HMM:SCOP  5->70 1r73A_ a.2.2.1 * 6.9e-19 62.1 %
:RPS:PFM   30->64 PF00831 * Ribosomal_L29 5e-09 71.4 %
:HMM:PFM   7->64 PF00831 * Ribosomal_L29 7.7e-28 60.3 58/58  
:BLT:SWISS 1->79 RL29_NOCFA 9e-27 100.0 %
:PROS 43->57|PS00579|RIBOSOMAL_L29
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55586.1 GT:GENE rpmC GT:PRODUCT putative ribosomal protein L29 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 799190..799429 GB:FROM 799190 GB:TO 799429 GB:DIRECTION + GB:GENE rpmC GB:PRODUCT putative ribosomal protein L29 GB:PROTEIN_ID BAD55586.1 LENGTH 79 SQ:AASEQ MATGTPAAELRELTEEELVSRLRESKEELFNLRFQMATGQLDNNRRLRVVRHEIARIYTVMRERELGLATGPAGKGDAA GT:EXON 1|1-79:0| SW:ID RL29_NOCFA SW:DE RecName: Full=50S ribosomal protein L29; SW:GN Name=rpmC; OrderedLocusNames=NFA_7410; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|RL29_NOCFA|9e-27|100.0|79/79| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 43->57|PS00579|RIBOSOMAL_L29|PDOC00501| SEG 9->29|elrelteeelvsrlreskeel| BL:PDB:NREP 1 BL:PDB:REP 32->68|1r73A|3e-08|54.1|37/66| RP:PDB:NREP 1 RP:PDB:REP 30->66|3bboZ|3e-12|35.1|37/65| RP:PFM:NREP 1 RP:PFM:REP 30->64|PF00831|5e-09|71.4|35/58|Ribosomal_L29| HM:PFM:NREP 1 HM:PFM:REP 7->64|PF00831|7.7e-28|60.3|58/58|Ribosomal_L29| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00831|IPR001854| GO:PFM GO:0005622|"GO:intracellular"|PF00831|IPR001854| GO:PFM GO:0005840|"GO:ribosome"|PF00831|IPR001854| GO:PFM GO:0006412|"GO:translation"|PF00831|IPR001854| RP:SCP:NREP 1 RP:SCP:REP 30->67|1vs6X1|2e-12|42.1|38/63|a.2.2.1| HM:SCP:REP 5->70|1r73A_|6.9e-19|62.1|66/0|a.2.2.1|1/1|Ribosomal protein L29 (L29p)| OP:NHOMO 78 OP:NHOMOORG 78 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111111111-1111111111111111111111-11111111111-----------------------------------------------------------------------------------------------------------------------------------11------------11---------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 40 STR:RPRED 50.6 SQ:SECSTR #############################HHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHc########## DISOP:02AL 1-3, 37-47, 65-79| PSIPRED ccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //