[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpmD
DDBJ      :rpmD         putative ribosomal protein L30
Swiss-Prot:RL30_NOCFA   RecName: Full=50S ribosomal protein L30;

Homologs  Archaea  0/68 : Bacteria  176/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.59.1
:59 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->58 1vs6Y PDBj 7e-09 47.3 %
:RPS:PDB   1->59 1bxyA PDBj 1e-16 47.5 %
:RPS:SCOP  1->59 1bxyA  d.59.1.1 * 5e-17 47.5 %
:HMM:SCOP  1->60 1bxyA_ d.59.1.1 * 1.6e-17 51.7 %
:RPS:PFM   4->54 PF00327 * Ribosomal_L30 2e-07 51.0 %
:HMM:PFM   4->54 PF00327 * Ribosomal_L30 1.2e-21 35.3 51/52  
:BLT:SWISS 1->59 RL30_NOCFA 1e-28 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55637.1 GT:GENE rpmD GT:PRODUCT putative ribosomal protein L30 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 857668..857847 GB:FROM 857668 GB:TO 857847 GB:DIRECTION + GB:GENE rpmD GB:PRODUCT putative ribosomal protein L30 GB:PROTEIN_ID BAD55637.1 LENGTH 59 SQ:AASEQ MADLKVTQIKSSIGAKKNQRDSLRTLGLRGIRKSVVREDNPQNRGLINVVRHLVTVEEV GT:EXON 1|1-59:0| SW:ID RL30_NOCFA SW:DE RecName: Full=50S ribosomal protein L30; SW:GN Name=rpmD; OrderedLocusNames=NFA_7920; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->59|RL30_NOCFA|1e-28|100.0|59/59| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 4->58|1vs6Y|7e-09|47.3|55/58| RP:PDB:NREP 1 RP:PDB:REP 1->59|1bxyA|1e-16|47.5|59/60| RP:PFM:NREP 1 RP:PFM:REP 4->54|PF00327|2e-07|51.0|51/52|Ribosomal_L30| HM:PFM:NREP 1 HM:PFM:REP 4->54|PF00327|1.2e-21|35.3|51/52|Ribosomal_L30| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00327|IPR000517| GO:PFM GO:0005622|"GO:intracellular"|PF00327|IPR000517| GO:PFM GO:0005840|"GO:ribosome"|PF00327|IPR000517| GO:PFM GO:0006412|"GO:translation"|PF00327|IPR000517| RP:SCP:NREP 1 RP:SCP:REP 1->59|1bxyA|5e-17|47.5|59/60|d.59.1.1| HM:SCP:REP 1->60|1bxyA_|1.6e-17|51.7|60/60|d.59.1.1|1/1|Ribosomal protein L30p/L7e| OP:NHOMO 176 OP:NHOMOORG 176 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111111111111111111111--1-111111111111-111111--1-1-----------------1--1----------------------------11--11111111-1----------------------------------------------11---------------1111-1---111-111-------1-1111111111111111111----------------------1---11111111111111111111111111111111111111111111----------------1--1-----------1---1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEccccTTccHHHHHHHHHHTcccTTcEEEEEccHHHHHHHHHTTTTEEEEEE DISOP:02AL 59-60| PSIPRED ccEEEEEEEEccccccHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHEEEEEc //