[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpmE2
DDBJ      :rpmE2        putative ribosomal protein L31
Swiss-Prot:RL31_NOCFA   RecName: Full=50S ribosomal protein L31;

Homologs  Archaea  0/68 : Bacteria  564/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->66 2hgu3 PDBj 3e-21 62.5 %
:RPS:PDB   2->72 3bbo1 PDBj 4e-22 24.3 %
:RPS:SCOP  1->71 1vs6Z1  d.325.1.2 * 4e-26 48.6 %
:HMM:SCOP  1->71 1vs6Z1 d.325.1.2 * 2.3e-23 48.6 %
:RPS:PFM   1->67 PF01197 * Ribosomal_L31 2e-17 62.7 %
:HMM:PFM   1->67 PF01197 * Ribosomal_L31 5.5e-34 61.2 67/69  
:BLT:SWISS 1->76 RL31_NOCFA 7e-43 100.0 %
:PROS 36->57|PS01143|RIBOSOMAL_L31

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55898.1 GT:GENE rpmE2 GT:PRODUCT putative ribosomal protein L31 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1164178..1164408 GB:FROM 1164178 GB:TO 1164408 GB:DIRECTION + GB:GENE rpmE2 GB:PRODUCT putative ribosomal protein L31 GB:PROTEIN_ID BAD55898.1 LENGTH 76 SQ:AASEQ MKAGIHPAYVDTTVVCGCGNTFQTRSTKESGHITVEVCSQCHPFYTGKQKILDTGGRVARFEARYGKRAGKKADAK GT:EXON 1|1-76:0| SW:ID RL31_NOCFA SW:DE RecName: Full=50S ribosomal protein L31; SW:GN Name=rpmE; OrderedLocusNames=NFA_10530; SW:KW Complete proteome; Metal-binding; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->76|RL31_NOCFA|7e-43|100.0|76/76| GO:SWS:NREP 5 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 36->57|PS01143|RIBOSOMAL_L31|PDOC00880| BL:PDB:NREP 1 BL:PDB:REP 1->66|2hgu3|3e-21|62.5|64/71| RP:PDB:NREP 1 RP:PDB:REP 2->72|3bbo1|4e-22|24.3|70/72| RP:PFM:NREP 1 RP:PFM:REP 1->67|PF01197|2e-17|62.7|67/69|Ribosomal_L31| HM:PFM:NREP 1 HM:PFM:REP 1->67|PF01197|5.5e-34|61.2|67/69|Ribosomal_L31| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01197|IPR002150| GO:PFM GO:0005622|"GO:intracellular"|PF01197|IPR002150| GO:PFM GO:0005840|"GO:ribosome"|PF01197|IPR002150| GO:PFM GO:0006412|"GO:translation"|PF01197|IPR002150| RP:SCP:NREP 1 RP:SCP:REP 1->71|1vs6Z1|4e-26|48.6|70/70|d.325.1.2| HM:SCP:REP 1->71|1vs6Z1|2.3e-23|48.6|70/0|d.325.1.2|1/1|L28p-like| OP:NHOMO 589 OP:NHOMOORG 566 OP:PATTERN -------------------------------------------------------------------- 1111111111111121111-11111111111111112221111111111111111--1--1212211232112221111111--1111-----1111-----------1----------------111111111-111111111-1-11-111-11111-1--11-1--1-1---111-1-11---11111111----------------11111---111----------11-------------------------------------------111--------------------------------------------111111111111111111111111-1111111111111111111111-1--11-11------1---1---1-11-------------------------111-111111-----------------111111111111--11-------------------------------1--------111111111111111111111111111111111-----------11111111111111111-1111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111-11--1111111-111111111-1-1-11-1111111111111111111111112211111111111111111111111-11111111111111111111111-1111111111111111111111111111111---111111111111111-111111111111121112222211111---1-11-------1111111111--------11---1-------------1--------111111-1111-- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 94.7 SQ:SECSTR ccTTTcccccHHHHHcccccTTTccccccccccccccccccccccccccccccccccccccccccccccccc#### DISOP:02AL 66-76| PSIPRED ccccccccEEEEEEEEccccEEEEEEcccccEEEEEEccccccEEcccEEEEEccccHHHHHHHHccccccccccc //