[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpmI
DDBJ      :rpmI         putative ribosomal protein L35
Swiss-Prot:RL35_NOCFA   RecName: Full=50S ribosomal protein L35;

Homologs  Archaea  0/68 : Bacteria  73/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.301.1
:64 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->44 3bbo5 PDBj 2e-09 50.0 %
:RPS:PDB   3->47 3bbo5 PDBj 7e-06 46.7 %
:RPS:SCOP  2->47 2hgj71  d.301.1.1 * 1e-06 37.0 %
:HMM:SCOP  2->65 2i2t31 d.301.1.1 * 5.9e-21 57.8 %
:HMM:PFM   2->62 PF01632 * Ribosomal_L35p 1e-24 49.2 61/61  
:BLT:SWISS 1->64 RL35_NOCFA 4e-26 100.0 %
:PROS 5->31|PS00936|RIBOSOMAL_L35
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56761.1 GT:GENE rpmI GT:PRODUCT putative ribosomal protein L35 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2092942..2093136 GB:FROM 2092942 GB:TO 2093136 GB:DIRECTION + GB:GENE rpmI GB:PRODUCT putative ribosomal protein L35 GB:PROTEIN_ID BAD56761.1 LENGTH 64 SQ:AASEQ MPKMKSHSGASKRFKVSGKGKLLRQQANRRHLLEHKPSRRTRRLDGTEVVAAADVRRVKKLLGR GT:EXON 1|1-64:0| SW:ID RL35_NOCFA SW:DE RecName: Full=50S ribosomal protein L35; SW:GN Name=rpmI; OrderedLocusNames=NFA_19150; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->64|RL35_NOCFA|4e-26|100.0|64/64| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 5->31|PS00936|RIBOSOMAL_L35|PDOC00721| SEG 49->58|vvaaadvrrv| BL:PDB:NREP 1 BL:PDB:REP 3->44|3bbo5|2e-09|50.0|42/62| RP:PDB:NREP 1 RP:PDB:REP 3->47|3bbo5|7e-06|46.7|45/62| HM:PFM:NREP 1 HM:PFM:REP 2->62|PF01632|1e-24|49.2|61/61|Ribosomal_L35p| RP:SCP:NREP 1 RP:SCP:REP 2->47|2hgj71|1e-06|37.0|46/63|d.301.1.1| HM:SCP:REP 2->65|2i2t31|5.9e-21|57.8|64/0|d.301.1.1|1/1|L35p-like| OP:NHOMO 73 OP:NHOMOORG 73 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-1111111111111111111111111-1-111111111111111111111111----------1------------------------------------------11----1--1------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 47 STR:RPRED 73.4 SQ:SECSTR cccccccHHHHTTcccccccccEEEccccTTcccccccccTTcccEE################# DISOP:02AL 1-7, 29-47| PSIPRED ccccccccccccEEEEccccEEEEcccccccccccccHHHHccccccEEEcHHHHHHHHHHHcc //